KEGG   Sinorhizobium meliloti AK83: Sinme_0666Help
Entry
Sinme_0666        CDS       T01521                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sinme_0666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smk02000]
    Sinme_0666
Enzymes [BR:smk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sinme_0666
Transporters [BR:smk02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sinme_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C Tom37 PEPCK_N GST_C_2
Motif
Other DBs
NCBI-ProteinID: AEG52425
LinkDB All DBs
Position
1:698845..699465
Genome map
AA seq 206 aa AA seqDB search
MLKLFYTPGTCSLASHIALEEAGAGYEVHRVDFSKAEQTKPDYLTINPKGRVPALVTDRG
ILTETPAILAYIAQSFPKARLAPLDDPFEFARLQSFLSYLCSTVHVAHAHARRAARWADD
PAAQEAMKAKVPQNMADCFALIERTMFVGPFVRGDAYSVADPYLFTIAGWLESDGVDPAR
FPRILDHRNRMAERPAVAKVLAEVQS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgttttatacgcccggaacctgctcgcttgcctcgcacatcgcgttagag
gaagccggtgccggctatgaagtgcatcgggtcgatttttccaaagccgagcagaccaag
ccggactacctcaccatcaaccccaaggggcgggtgcccgccctcgtgaccgaccgtggt
atcctgaccgagacgccggccattctcgcctatatcgcccagagcttcccgaaggcgcgg
cttgcgccgcttgacgatcctttcgagttcgctcggctgcagtcgttcctgagctatctc
tgctcgacagtccacgtcgcccatgcccatgcccgtcgagccgcgcggtgggcagacgac
ccggcagcgcaggaggcgatgaaggccaaggtgccgcagaatatggccgactgcttcgcg
ctgatcgagcgcacgatgttcgtcggcccctttgtcaggggcgacgcctactcggtcgcc
gatccctacctcttcaccatcgccggctggctcgagtcggacggtgtcgatccggcccgg
tttccgcgaatcctcgaccatcgcaacaggatggccgagcgtccggccgtcgccaaggtt
ctggctgaagtgcagtcgtag

DBGET integrated database retrieval system