KEGG   Sinorhizobium meliloti AK83: Sinme_0891Help
Entry
Sinme_0891        CDS       T01521                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Brite
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sinme_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEG52646
LinkDB All DBs
Position
1:897263..897781
Genome map
AA seq 172 aa AA seqDB search
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaacgatgattgcgatcgcctgtgcggcaggaatggcgggtgccgcttcggca
caacagtcctcgcagacggcgacggccgagttcgtgggcaaggacggcacggacatcggc
cgggccactttgacggcaggcggcaagggcgtgctgatcgagatggagataagcggcctg
ccgaaggatacctgggtggcttttcacgctcacgaaatggggcgctgcgatcccaaggac
gggttcgagtcggcgggaaagcattttgccggcgaagatgagaatgccgagcacggcttc
ctcgcttccaatggcccgcatgccggcgacatgccgaaccagtatgtcggtgccgatgga
accttgcgcgcccaggtcttcaacagcttcgtgtccctcgacgacagggctaccgccctt
cgcggccgggccctggtgatccatgtgcattcggacgacaatcgcagccagccctccggc
gatgccggcgaccggctggcctgcgcggtggtgaagtag

DBGET integrated database retrieval system