KEGG   Sinorhizobium meliloti AK83: Sinme_1131Help
Entry
Sinme_1131        CDS       T01521                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
smk  Sinorhizobium meliloti AK83
Brite
Translation factors [BR:smk03012]
 Eukaryotic Type
  Elongation factors
   Sinme_1131
 Prokaryotic Type
   Sinme_1131
Mitochondrial biogenesis [BR:smk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Sinme_1131
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Sinme_1131
  Exosomal proteins of breast cancer cells
   Sinme_1131
  Exosomal proteins of colorectal cancer cells
   Sinme_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEG52882
LinkDB All DBs
Position
1:1154223..1155398
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQILCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaataagccgcacgtcaacattggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgctgcgccggaagaaaaggcccgcggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccgaaccgtcactatgcgcatgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtttcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgcggaa
ctgctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggctctggccgcgcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtgaccggtcgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgcttcgcggtgtcgac
cgcaacggcgtcgagcgcggtcagattctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgtgccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system