KEGG   Sinorhizobium meliloti AK83: Sinme_1472Help
Entry
Sinme_1472        CDS       T01521                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
Organism
smk  Sinorhizobium meliloti AK83
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3 adh_short 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEG53216
LinkDB All DBs
Structure
PDB: 

Position
1:complement(1481895..1482938)
Genome map
AA seq 347 aa AA seqDB search
MKAVRLESVGNISVRNVGIPEPGPDDLLVKVEACGICGTDRHLLHGEFPSTPPVTLGHEF
CGIVVEAGSAVRDIAPGARITGDPNISCGRCPQCQAGRVNLCRNLRAIGIHRDGGFAEYV
LVPRKQAFEIPLTLDPVHGAFCEPLACCLHGVDLSGIKAGSTVAILGGGVIGLLTVQLAR
LAGATTVILSTRQATKRRLAEEVGATATVDPSAGDVVEAIAGPAGLVPGGVDVVIECAGV
AETVKQSTRLAKAGGTVVILGVLPQGEKVEIEPFDILFRELRVLGSFINPFVHRRAADLV
ATGAIEIDRLISRRISLDEAPDVISNPAAAGEVKVLVVPSAERVAQQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtgcgtcttgagtcggtcggcaatatctccgttcggaacgttgggattcct
gagcccgggcctgacgatctgctcgtcaaagtggaagcctgcggcatctgcgggaccgat
cgtcatctccttcatggagaatttccgtcgacgccgccggtcacgctcggccacgaattc
tgcggcatcgtcgtcgaggccgggagcgccgttcgagacatcgcaccgggtgcgaggatc
accggagatcccaacatctcctgcggccgctgcccgcagtgccaggcgggccgggtcaat
ctctgccggaacctgcgcgcgatcggcatccatcgcgacggcggcttcgccgaatacgtc
ctggtgccgcggaaacaggccttcgaaattccgcttactctcgatcccgtgcacggcgct
ttctgcgagcctctcgcctgctgcctgcacggtgtcgatctttcgggaatcaaagcgggg
tcgacggtggcgatcctgggcggcggcgtgatcggcctgctgacggtgcagctcgcaagg
ctcgccggcgccacgacggtcattctctcgacacgccaggcaacgaagcgtcgcctggcc
gaggaggtcggcgccaccgcaacggtcgacccgtcggccggcgacgtggtcgaggcgatc
gcaggtccggcaggtctcgtccccggaggcgtcgatgtcgtcatcgagtgcgccggagtc
gcagaaacggtgaagcagtcgacgcgcctcgccaaagcgggcggtacggtcgtgatcctc
ggcgtgctgccgcagggagaaaaggtcgaaatcgaaccgttcgacattctcttccgcgag
ctccgtgtgcttggttcctttatcaatcccttcgtccaccgccgcgcggccgacctggtt
gcgacaggcgcgatcgagatcgaccggttgatttcacgtcgcatatcgctcgatgaagca
ccagatgtcatttcaaatcccgccgctgccggcgaggtgaaggtattggtggtcccgtcc
gccgagcgggtggcgcagcagtag

DBGET integrated database retrieval system