KEGG   Sinorhizobium meliloti AK83: Sinme_2151Help
Entry
Sinme_2151        CDS       T01521                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00473  D-Alanine metabolism
smk00550  Peptidoglycan biosynthesis
smk01100  Metabolic pathways
smk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sinme_2151
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinme_2151
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sinme_2151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smk01011]
    Sinme_2151
Enzymes [BR:smk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sinme_2151
Peptidoglycan biosynthesis and degradation proteins [BR:smk01011]
 Precursor biosynthesis
  Amino acid ligase
   Sinme_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A CPSase_L_D2 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEG53871
LinkDB All DBs
Position
1:complement(2151048..2151974)
Genome map
AA seq 308 aa AA seqDB search
MSSKHVAVLLGGFSSERPVSLSSGTACADALEAEGYRVTRVDVGRDVAAVLQELRPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLSSALAMDKDQAKHVAKAAGIPVAEALVMDR
RSFGNQHPMKPPYVVKPVREGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYIAGR
EFTCGVMGDVALGVTEIIPQGHAFYDYDSKYVKGGSKHVIPAQISPNIYQKIQTLALKAH
QAIGCRGVSRSDFRFDDRGDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagcatgttgctgtcctgttgggcggattttcctcggagaggccggtgagc
ctgtcttcggggactgcttgcgcggatgccctggaggccgaaggctatcgcgtcacgcgc
gtcgatgtcggtcgcgacgtcgcggcggttcttcaggaattgcgtccggatgtcgtcttc
aacgcgcttcatgggccgttcggcgaggacgggacgatccagggcattctcgaatatctc
gagattccctatacccattcgggcgttttgtcctcggcgctggccatggataaagatcag
gcaaagcatgtcgccaaggctgccggcattccggttgccgaagccttggtcatggaccgg
cgcagcttcggcaatcagcacccgatgaagccgccttacgtggtgaagccggtccgcgag
gggtcgagcttcggagtggtgatcgtcaaggaggatcagtcgcatccgcctcaggtgatc
acctcgagcgagtggcgctacggcgaccgcgtcatggtcgagcgctatattgcggggcgc
gaattcacctgcggtgtcatgggcgacgtcgccctcggcgtcactgaaatcattccgcag
gggcacgccttctacgattacgactcgaaatacgtaaaaggtggttcgaagcacgtcata
cctgcacagatttcaccaaatatttaccaaaaaatacaaacactggcgttgaaggcgcat
caggcgatcggttgccgcggcgtcagccggtccgactttcgtttcgacgatcgtggggat
ggtgagggcgagttgatctggctcgagatcaacacccaacccggcatgaccccaacatcc
ctggtgcccgaaatggcgcagcatgctggccttcagttcggtgaatttctcaggtggatg
gtggaggacgcgtcgtgcttgcgctga

DBGET integrated database retrieval system