KEGG   Sinorhizobium meliloti AK83: Sinme_2396Help
Entry
Sinme_2396        CDS       T01521                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00010  Glycolysis / Gluconeogenesis
smk00620  Pyruvate metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_2396
   00620 Pyruvate metabolism
    Sinme_2396
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Sinme_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEG54113
LinkDB All DBs
Position
1:complement(2395973..2397481)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVENPYKQKYGNFIGGEWREPVAGRYFDNTTPITGGTLCEVARSDAADIEIALDA
AHAAREKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPGSILVWAELIGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVASEDDDFFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDEATMIGAQASSEQLEKILAYIEIGKEEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFHGHNRMRIFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagaacccctacaagcagaaatacgggaacttcatcggc
ggcgaatggcgcgaacccgttgcaggccgctatttcgacaacacgacgccgatcaccggc
ggcacgctttgcgaggtcgcgcgttcggacgccgccgacatcgagatcgccctcgacgcg
gcgcacgccgcaagggagaaatggggccggacctcgacgacggagcggtcgaacattctg
atgaagatcgccgcccgcatggaggacaatctggagcttctggcacgggcggaaacctgg
gacaacggcaagccgatccgcgagacgatggccgccgacattccgctggcgatcgatcat
ttccgctatttcgcggcctgcatccgtgcacaggaaggctcgatcggcgagatcgaccac
gacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggaaactgc
gtcgtgctgaagccggccgagcagacgccgggctcgatcctcgtctgggcggaactcatc
ggtgacctcctgccgccgggtgtcctcaacatcgtcaacggcttcggcctcgaagcgggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaacctcatcccggtcacgctggagctcggc
ggaaagtcgccgaacatcttcttcgcggacgtcgccagcgaggacgacgacttcttcgac
aaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtctgcacctgcccg
agccgggcactggtacaggagagcatctacgaccgcttcatggagcgggcggtaaagagg
gtcgaggcgatccggcagggcaatccgctcgatgaagcaaccatgatcggcgcccaggct
tcgagcgaacagctcgagaaaatcctcgcctatatcgaaatcggcaaggaggaaggtgcc
gaggtgctgaccggcggcgggcgcaacgtgctcgaaggcgatctttccggcggctactac
gtcaagccgaccgtattccacggccacaacaggatgcgcatctttcaggaggagattttc
gggccggtcgtgtcggtcacgaccttcaagacggaagccgaggcgctggaaatcgccaac
gacacgctctacgggcttggcgccggcgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgcgatcgaagccggccgggtctggaccaattgctaccacgcctatccggcg
cacgccgccttcggcggttacaagcagtccggcatcgggcgcgagacgcacaagatgatg
ctggatcactatcagcagacgaagaacatgctggtcagctacagcccgaaggctctcggc
ttcttctga

DBGET integrated database retrieval system