KEGG   Sinorhizobium meliloti AK83: Sinme_2445Help
Entry
Sinme_2445        CDS       T01521                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00240  Pyrimidine metabolism
smk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sinme_2445
Enzymes [BR:smk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Sinme_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEG54161
LinkDB All DBs
Position
1:complement(2449286..2449873)
Genome map
AA seq 195 aa AA seqDB search
MSKLYFSYATMNAGKSTLLLQAAYNYQGRGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactttatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggccgcctacaactatcaggggcgcggcatgcgcgtcgtgatgctgatagcagccttc
gacgatcgcgccggccagggtcgcatcgcgtctcgcatcgggctggaatcggaggcgatc
cccttccgcgcagaggatgatctccatgggctgatcgagcgcctgaacggcgacggctcc
ggtgaaatcgcctgcgtcttcgtggacgaggcgcagttcctcggtgaagatcaggtctgg
cagttggcgcgtgtggcggatcgcctcggcattccggtcatggcctatggcctgaggacg
gacttccagggcaagctcttccccggctccatggctctgctcgctatcgcggatgagttg
cgcgaagtcaggaccatctgccattgcgggcgcaaggcaacgatggtcgtccgcctcgac
ggccgcggcaaggtcatgcgggagggcgcgcaggtggatgtcggcggcaacgagaaatac
gtctcctattgccgtcgccattgggacgaccggatgcgcgaaggctga

DBGET integrated database retrieval system