KEGG   Sinorhizobium meliloti AK83: Sinme_2575Help
Entry
Sinme_2575        CDS       T01521                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00040  Pentose and glucuronate interconversions
smk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sinme_2575
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Sinme_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEG54289
LinkDB All DBs
Position
1:complement(2574079..2575119)
Genome map
AA seq 346 aa AA seqDB search
MAKALVLEKKGQLSLRDIPVRRDLSPTDVLIGIRTVGVCGSDVHYYTHGKIGPFVVNEPM
ILGHEAAGVVLEVGSQVRHLKKGDRVCMEPGIPGLSSRSSKLGIYNVDPSVRFWATPPVH
GCLTPEVVHPAAFTYRLPDHVSFAEGAMVEPFAIGVQAALRAGIRPGDVGAVMGAGPIGM
MTALAALAGGCSKVYVADLAQPKLDVIGAYEGIETINVRQQAVSEALAGATGGWGADVVF
ECSGAAPAILALPSLARPGGTVVLVGMPVEPVPFDIVGMQAKELRIETVFRYANVYDRAI
ELIASGKVDLKPLISATIPFDESIAAFDRAVEARPTDVKIQIEMPA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgcttgtacttgaaaagaaggggcagttgtcgctgcgcgacatcccggtc
cggcgggatctgtcgccgaccgacgtgctgatcggaatccgcaccgtcggcgtttgcggc
tccgatgtccactattatacccatggaaagatcgggccctttgtcgtcaacgagccgatg
atattgggccacgaggccgcgggcgtcgttctggaggtcggctcgcaagtccggcatctg
aagaagggtgaccgtgtctgcatggaacccggcattccgggcctctcctcccggtcgtcc
aagctgggcatctacaatgtcgatccgtccgtacggttctgggccacgccgccggtccat
ggatgcctgacgcccgaggtcgttcatccggcggccttcacctatcgtctgcccgaccac
gtgtccttcgcggaaggggcgatggtcgagccgttcgccatcggcgtacaggccgccctt
cgcgcgggcatcaggccaggcgatgtcggcgccgtcatgggggccggcccgatcggcatg
atgacggcactggccgcgctcgcggggggatgctccaaggtctacgtggccgacctcgcg
cagccgaagctggatgtcatcggggcctatgagggtatcgagacaatcaatgtccgccag
caggcggtatccgaggctctcgcgggggcgacgggcggctggggggcggatgtcgtcttc
gagtgctccggagccgcacccgcaatccttgctcttccgagtcttgcgcgcccgggcgga
accgtcgtgctcgtcggcatgcccgtcgaacccgtccccttcgatatcgtcggtatgcag
gccaaggaactgcggatcgagaccgtgttccgctatgccaatgtctacgaccgcgctatc
gaactgatcgcctccggcaaggtcgatttgaaaccgctgatctcggcgaccattccgttc
gacgagagtatcgcggccttcgaccgcgccgtcgaggcgcgccccacggacgtgaagata
cagatcgagatgccggcttaa

DBGET integrated database retrieval system