KEGG   Sinorhizobium meliloti AK83: Sinme_2733Help
Entry
Sinme_2733        CDS       T01521                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01230  Biosynthesis of amino acids
Module
smk_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_2733
Enzymes [BR:smk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Sinme_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 TsaE AAA
Motif
Other DBs
NCBI-ProteinID: AEG54440
LinkDB All DBs
Position
1:complement(2743611..2744189)
Genome map
AA seq 192 aa AA seqDB search
MNDVTEPVSATLAERAKRTLGKRNLVFIGLMGAGKSAIGRLTAQALGVPFVDSDHEIERV
SRMTVSDLFATYGEEEFRALEARVLKRLLRSGPRVVSTGGGAYINERSRRHIKKGGLTIW
LNAELDVLWERVNKRDTRPLLKTENPKQTLENLMRARYPIYAEADLTVLSRDVKKEAMVE
EVLAAIADHQKA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtgaccgaaccggtttccgcgacgctggccgaaagggcgaagcgcactctc
ggtaagcgcaatctcgttttcatcggcctgatgggggcaggtaaatcggcaatcggtcgg
ctgaccgcccaggcgctcggcgttcctttcgtcgattccgaccacgagatcgagcgggtc
tcgcgcatgacggtcagcgatctcttcgcgacctacggcgaggaagagttccgggcgctg
gaggcccgcgtgctgaagcgcctgctcaggtccggcccgcgggtggtgtcgaccggcggc
ggcgcctatatcaacgagcgctcgcggcggcatatcaagaagggcggcctgacgatctgg
ctcaacgccgagcttgacgtgctatgggagcgggtaaacaagcgcgacacccggccgctt
ctgaagaccgagaatccgaagcagacgctcgagaacctgatgcgcgcgcgctacccaatc
tatgccgaggcggacctgaccgttctctcgcgcgatgtgaaaaaggaagcgatggtcgag
gaggttctcgccgccatcgccgatcatcagaaagcctga

DBGET integrated database retrieval system