KEGG   Sinorhizobium meliloti AK83: Sinme_3068Help
Entry
Sinme_3068        CDS       T01521                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00564  Glycerophospholipid metabolism
smk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sinme_3068
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sinme_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 K_oxygenase GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEG54775
LinkDB All DBs
Position
1:3127354..3128865
Genome map
AA seq 503 aa AA seqDB search
MSEQTIFDVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMTRDPAGAPLKGLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGRWAIEIESTETGARETMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLC
RAASEYFSDPVGREDIVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALEKIGETIGEKGRKWTAVSHLPGGDFPAAGYDDEVAKLRTRYPFLTASHA
RRLVRLYGTRAAQLLGNAASEADLGKHFGADLYAAEVDWLIVQEWALRAEDVLWRRTKLG
LKFSRAQTAELEEYMRGAVNAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcagacgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggctggccgcggatattccgtcgcgctggcggagatgagcgatttc
gcctccggaacatcctccggctcgaccaagctcatccatggcggcttgcgctatctcgaa
cattatgaattccgcctcgtgcgcgaagccctgatggagcgcgaagtcctctgggcgatg
gcgccgcacgtgatctggccgatgcgcttcgtgctgcccttccacaagggtggtccgcgg
ccggcatggctgatccgcctcggcctcttcctttacgatcatataggcggccgtaagctt
ctgccggcgacgaagacgctcgacatgacgcgcgatcccgcgggcgcaccgctgaagggc
ctcttcaccaaagcattcgaatattcggacggctgggtcgacgatgctcgcctcgtggtg
ctgaacgcgcgcgacgccgccgaccgcggcgcgaggatcatggcacgcacccgcgtcgtc
tcggcgcgccgcgagggcggccgttgggcaatcgaaatcgagagcacggagacgggcgcg
cgcgagacgatgcgcgcccgcatgctcgtcaatgccgcgggcccctgggtggaccgggtt
ctctccgaagcggtcggcaacaacgacgtccgcaatgtccgcctggtccagggcagccat
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccttaccaggacgagttcacgctgatcggaaccaccgatcgc
gatttcaccggcaatccggctgacgtgcgcatcagcgatgcggagatagattatctctgc
agggcggcgagcgaatatttcagcgacccggtcggcagagaggatatcgtgtggacctat
tccgccgtgcgcccccttttcgatgacggtgcgagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcaccgctgctcaacgtcttcggcggcaagctc
accacctacaggcggcttgcggaatcggcgctcgagaagatcggcgagaccatcggggaa
aagggcaggaaatggacggccgtatcgcatctgccgggcggcgattttccggccgccggc
tatgacgacgaggtcgcgaagctcaggacgcgctatcctttcctgaccgcttcccacgcc
cgccggctggtacggctctacggcacgcgggcggcgcagcttctcggcaatgccgcgagc
gaggccgacctcggaaagcacttcggcgcggatctctatgctgcggaagtggattggctc
atcgtgcaggaatgggcattgcgcgcggaggacgtgctttggcgccgcacgaaactggga
ctgaagttttcgcgggcgcaaaccgcggaactggaggaatatatgcggggcgcggtcaac
gcggccgcctga

DBGET integrated database retrieval system