KEGG   Stenotrophomonas maltophilia K279a: Smlt0840Help
Entry
Smlt0840          CDS       T00718                                 

Gene name
ahpF
Definition
(GenBank) putative alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sml  Stenotrophomonas maltophilia K279a
Brite
KEGG Orthology (KO) [BR:sml00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smlt0840 (ahpF)
Enzymes [BR:sml01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Smlt0840 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 K_oxygenase Thi4 NAD_binding_8 FMO-like Thioredoxin_4 dsrm
Motif
Other DBs
NCBI-ProteinID: CAQ44416
UniProt: B2FPY6
LinkDB All DBs
Position
complement(880285..881877)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLESLSDKISLQVLRDGQG
RVPSFDLGTPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQDEVEKREIMSVPTVYLNGDV
FDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMNLQRASALVPAGEDG
LVQVQLENGAVLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLRSLANVTVLTSAQTTEVLGDG
SRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDVVALSPRGEVVIDDRGQTNLP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSNSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctgcagtcgcagctgaagacctatctggagcgcgtgacccgcccg
atccagatcaccgcgcacgccgacgacggggccaagtcgcaggagatgctggaactgctg
cagaccctggaaagcctgtcggacaagatctcgctgcaggtgctgcgcgatggccagggc
cgcgtgccgtccttcgacctgggcaccccgggccaggacatccacctgaccttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtgggcggtcat
ccgtccaaggccaccgccgagctgatcgagcaggtgcagaacctggaaggcgactaccgc
ttcgaaacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggcggcggtgctcaacccgcgcatccagcacgtggccatcgacggtgccctgttccag
gacgaagtcgagaagcgcgagatcatgtcggtgccgaccgtgtacctcaacggcgacgtg
ttcgaccagggccgcatgaccctcgagcagatcgtggccaagctggacaccaatgccagc
aagcgcgatgccgagaagatcgccgccaaggacgccttcgacgtgctggtggtgggcggt
ggcccggccggtgctgcagcggcgatctacgccgcacgcaagggcatccgcaccggcatc
gccgccgagcgtttcggtggccaggtgctggacaccatggcgatcgagaacttcatttcg
gtgaaggagaccgaaggcccgaagctggccacggcactggaacagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccagcgcgctggtgccggccggtgaagacggc
ctggtgcaggtgcagctggagaacggcgcggtgctgaagtcgcgttcggtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgccgggcgaagaccagtaccgcaacaagggc
gtggcctattgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtgtcgcatgta
accctgctggagttcgattccagcctgcgcgccgatgaagtgctgcagaagaagctgcgc
agcctggccaatgtcaccgtgctgaccagcgcacagaccaccgaagtgctgggcgacggc
agccgtgtcaccggcctggtctacaaggaccgcgtcggcggcgacgcccaccgcgtcgag
ctggagggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgaaggatgtg
gtggcgttgtcgccgcgtggcgaggtcgtcatcgacgaccgcggccagaccaacctgccg
ggtgtgttcgctgctggcgattgcacgacggtaccctacaagcagatcatcattgccatg
ggcgccggttcgaccgccgcactgagcgcgttcgaccacctgatccgctcgtcggtgagc
aacagcagcggtgccgttgctgaagcggcctga

DBGET integrated database retrieval system