KEGG   Stenotrophomonas maltophilia K279a: Smlt1607Help
Entry
Smlt1607          CDS       T00718                                 

Gene name
sspA
Definition
(GenBank) putative stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
sml  Stenotrophomonas maltophilia K279a
Brite
KEGG Orthology (KO) [BR:sml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sml03021]
    Smlt1607 (sspA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sml02000]
    Smlt1607 (sspA)
Transcription machinery [BR:sml03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Smlt1607 (sspA)
Transporters [BR:sml02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smlt1607 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CAQ45138
UniProt: B2FJ99
LinkDB All DBs
Position
1672238..1672873
Genome map
AA seq 211 aa AA seqDB search
MAASVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTFDFVPVDPQNPPEDLIDLNPYHSVP
TLVERELVLYAASVVSEYLDERYPHPPLMPVDPLSRARIRLAMLRIEHDWVPQVQAIQLG
NKTQAEAGRKRLKELLTASLPLFKASKFFLNPEMSLADCAMAPIIWRLQSLDVPLPKDGK
AIEDYGNRIFRHPGFVRSLTDQEKKLRDLPV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgagcgtacgcatgcgcaatacactgacgctgttttcctcgaacgacgatgta
ctgtgccaccgtgtacgcctggtgctggcggccaagggtgtgaccttcgacttcgttccg
gtcgatccacagaacccgcctgaagacctgatcgacctcaatccgtatcactcggtgccg
accctggtcgaacgcgagctggtgctgtacgccgcatcagtggtcagcgagtacctggac
gaacgttatccgcatccgccgctgatgccggtcgatccgctctcgcgtgcgcgcatccgc
ctggcgatgctgcgcatcgagcacgactgggtgccacaggtgcaggccatccagctcggc
aacaagacccaggccgaggctggccgcaagcgcctgaaggagctgctgaccgcctcgctg
ccgctgttcaaggccagcaagttcttcctcaacccggaaatgagcctggccgactgcgcg
atggcgccgatcatctggcgcctgcagtcgctggacgtaccgctgccgaaggacggcaag
gcgatcgaggactacggcaaccgcatcttccgccaccccggtttcgtccgcagcctgacc
gatcaggaaaagaagctgcgcgatctgccggtctga

DBGET integrated database retrieval system