KEGG   Stenotrophomonas maltophilia K279a: Smlt2023Help
Entry
Smlt2023          CDS       T00718                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Smlt2023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sml02000]
    Smlt2023
Enzymes [BR:sml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Smlt2023
Transporters [BR:sml02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smlt2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAQ45532
UniProt: B2FN11
LinkDB All DBs
Position
2043748..2044464
Genome map
AA seq 238 aa AA seqDB search
MQASPRIIPMRIVHHLENSRSLRVLWMLEELGLDYELRRYPRDPKTLLAPPELRNVHPLG
KSPVLQDGELVLAESGAILDYLADRYDTQRQLSPSPMPADGAERIAYRYWLHYAEGSAMP
PLLLTLVMGRIRNAPMPFFARPIARSIADKAERGFIGPQRRLHLDWMERRLSESPWFAGE
RFSAADIQMSFPIQAAAARGGGLDDKPALRGFLKRIGERPAYQRAEAHGGHLQALSGN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctccccaaggatcatccccatgcgcatcgtccaccacctggaaaactcccgt
tccctgcgtgtgctgtggatgctggaggagctggggctggactacgaactgcgccgttat
ccccgcgatccgaagacgctgctggcaccgcccgaactgcgtaacgtgcatccgctgggc
aagtcgccggtgctgcaggatggcgagctggtactggccgagtccggtgccatcctcgac
tacctcgcggatcgctatgacacccaacgccagctgtcgccgtcaccgatgccggccgat
ggcgccgagcgcatcgcctaccgctactggctgcactacgccgaaggctcggcgatgccg
ccgctgctgctgaccctggtgatgggccgcatccgcaacgcgccgatgccgttcttcgcc
cgcccgattgcgcgcagcatcgccgacaaggccgagcgtggcttcatcggcccacagcgg
cgcctgcacctggactggatggagcgccgcctgtctgaaagcccatggttcgccggcgaa
cgcttcagtgcggccgacatccagatgagcttcccgatccaggcggccgccgcgcgcggc
ggtggcctcgacgacaagccggcgctgcgtggcttcctcaagcgtatcggcgagcgcccg
gcctaccagcgtgccgaggcccacggcggtcatctgcaggcgctcagcggcaattga

DBGET integrated database retrieval system