KEGG   Stenotrophomonas maltophilia K279a: Smlt3160Help
Entry
Smlt3160          CDS       T00718                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00380  Tryptophan metabolism
sml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Smlt3160
Enzymes [BR:sml01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Smlt3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CAQ46604
UniProt: B2FL97
LinkDB All DBs
Position
3196447..3197721
Genome map
AA seq 424 aa AA seqDB search
MSDLLSRTHAIALDAADPLRPLRNEFLIPRHGGGEQTYFVGNSLGLQPRGAQAAVQEVMK
QWGELAVEGHFTGPTQWLSYHRLVSAQLARVVGALPSEVVAMNTLSVNLHLMMVSFYRPT
AQRPVILMEAGAFPTDRHAVEAQIRFHGFDPAECLVEVQPDEANGTISLTAIERAIAEHG
PRLALVLWPGVQYRTGQAFDLDAITRAARLQGARIGFDLAHSVGNLPLRLHDVAPDFAVW
CHYKYLNSGPGAVAGAFVHERHHRDTTLPRFAGWWGHEEATRFQMAPQFTPAIGAEGWQL
SNPPILGLAPLRASLDLFERAGMEALRSKSLALTGMLEALVRARLSGVLDIITPAEPQRR
GCQLSLRVIGGRERGRALFEHLRGIGVLGDWREPDVIRISPTPLYNRYLDVHHFVEEVEA
WAGL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgctcagccgcacccacgccattgctctggacgccgccgatccgctgcgc
ccgctgcgtaacgaattcctgattccgcgccatggcggtggcgagcagacctacttcgtc
ggcaactcgctgggcctgcagccgcgtggcgcccaggccgcggtgcaggaagtgatgaag
caatggggcgagctggcggtggaaggccacttcaccggcccgacgcagtggctgtcctac
caccgcctggtgagcgcgcagctggcccgcgtggtcggtgcactgcccagcgaagtggtg
gcgatgaacacgctgagcgtgaacctgcacctgatgatggtcagcttctaccgaccgacc
gcgcagcgcccggtgatcctgatggaagccggtgcgttcccgaccgaccgacacgcggtc
gaagcgcagatccgtttccacgggttcgaccccgccgagtgcctggtggaagtgcaaccg
gacgaagccaacggaacgatctcgctcaccgcgatcgagcgcgccatcgccgaacacggt
ccgcgccttgcactggtgctgtggcccggcgtgcagtaccgcaccggccaggccttcgac
ctcgatgcaatcacccgtgctgcccgcctgcagggcgcgcgcatcggcttcgacctggcg
cactcggtcggcaacctgccgctgcgcctgcatgacgtcgcacccgatttcgccgtgtgg
tgccactacaaatacctcaacagcggcccgggtgcggtggccggcgcgttcgtgcacgag
cgccatcaccgcgacaccacgctgccgcgctttgccggctggtggggccatgaggaagcc
acccgcttccagatggcaccgcagttcacccccgccatcggtgccgaaggctggcagctc
agcaatccgccgatcctcggcctggcgccgctgcgcgcgtcgctggacctgttcgagcgc
gccggcatggaggcactgcgcagcaagtcgctggcgttgaccggcatgctcgaagcgctt
gtacgtgcacgcctttccggcgtgctcgacatcatcaccccggccgagccacagcgccgc
ggctgccagctgtcattgcgcgtgatcggtgggcgcgagcgcggccgtgcgctgttcgag
cacctgcgcggcatcggcgtgctcggcgactggcgcgagccggacgtgatccgcatctcg
cccaccccgctctacaaccgctacctggacgtgcaccacttcgtcgaggaagtggaagcc
tgggccggcctctga

DBGET integrated database retrieval system