KEGG   Stenotrophomonas maltophilia K279a: Smlt3619Help
Entry
Smlt3619          CDS       T00718                                 

Gene name
aroK
Definition
(GenBank) putative shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01130  Biosynthesis of antibiotics
sml01230  Biosynthesis of amino acids
Module
sml_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smlt3619 (aroK)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Smlt3619 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_22 AAA_16 AAA_5 TsaE Cupin_2 Mg_chelatase Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: CAQ47036
UniProt: B2FQI7
LinkDB All DBs
Position
3674645..3675187
Genome map
AA seq 180 aa AA seqDB search
MNPAPNLILIGPMGAGKTCIGRRLAERFTLDFVDVDQAIVDAAGASIPTIFEHSGEAGFR
SHEREALARVLEGRGQLVSTGGGAVLDPGNRALIAQRGFVVYLRVSVNAQLERLARDKGR
PLLQRPDREQVLHDLAAHRDPLYRELADITLDTDPYTAADATAHLVVKLATQWQRQDLTP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgctccgaacctgatcctgatcggcccgatgggcgccggcaaaacctgcatc
ggccgccgcctggccgagcgcttcacgctggacttcgtcgatgtcgaccaggccatcgtc
gatgccgccggcgccagcatcccgaccattttcgagcactccggcgaagccggcttccgc
agccatgaacgcgaggcgcttgcccgcgtgctggaaggtcgcggccagctggtctccacc
ggcggcggcgcggtgctggatcctggcaaccgtgcgttgatcgcccagcgcggcttcgtg
gtctacctgcgggtcagcgtgaacgcgcagctggaacgcctggcccgcgacaaaggcagg
ccgctgctgcagcgcccggaccgtgagcaggtgctgcacgatctggccgcgcaccgcgac
ccgctgtaccgcgaactggccgacatcacccttgataccgacccgtacaccgctgccgac
gcgaccgcccacctggtggtcaagctggccacgcaatggcagcgccaggacctgacccca
tga

DBGET integrated database retrieval system