KEGG   Schistosoma mansoni: Smp_056440Help
Entry
Smp_056440        CDS       T01095                                 

Definition
(RefSeq) putative superoxide dismutase [mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smm  Schistosoma mansoni
Pathway
smm04068  FoxO signaling pathway
smm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Smp_056440
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Smp_056440
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Smp_056440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 8344988
NCBI-ProteinID: XP_018654488
GeneDB: Smp_056440
UniProt: G4VSQ5
LinkDB All DBs
Position
W
AA seq 217 aa AA seqDB search
MATSRILRSSINRNYGLRFKHTLPPLPYEPNALEPVISGEIMQLHHSKHHATYVNNLNIA
EEQYAEAISKSDVTKMISLQPALRFNGGGHINHSIFWHNLSSNGGGVPTGSLANAINDEF
GSFDNFKSKLSTATIAVQGSGWGWLGYNPNTKRLQIATCANQDPLEGTTGLKPLLGIDVW
EHAYYLQYKNVRPDYVKAIWDIINWSDVAKRFDLSRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccacttcgcgcattcttagatccagtatcaatcgtaattatggactacgctttaaa
catacattgccccctttaccgtatgaacctaacgctttggaacctgtaatatcaggagaa
attatgcagttgcatcattctaaacatcatgccacatatgttaataatctcaatattgct
gaggaacagtatgctgaagctatctcgaaaagtgatgttacaaaaatgatctctcttcag
ccagcactccgttttaatggtggaggacatatcaatcacagcatcttttggcataatctc
agttctaatggtgggggtgtccctacgggcagtttggctaacgctattaatgatgagttt
ggatcatttgataacttcaagtcaaagctgtctactgccacaattgctgtccagggttcg
ggttggggttggcttggatataatcccaacacaaagcgtttacaaattgccacatgcgct
aatcaagaccctcttgaagggactacgggtttaaagcctttacttggaatcgacgtttgg
gagcatgcatattatcttcagtacaaaaatgtacgtccagactatgtaaaggcgatttgg
gatatcataaattggagcgatgtagctaaacgattcgatctcagtaggaaataa

DBGET integrated database retrieval system