KEGG   Schistosoma mansoni: Smp_061230Help
Entry
Smp_061230        CDS       T01095                                 

Definition
(RefSeq) succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
smm  Schistosoma mansoni
Pathway
smm00020  Citrate cycle (TCA cycle)
smm00190  Oxidative phosphorylation
smm01100  Metabolic pathways
smm01200  Carbon metabolism
Module
smm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smp_061230
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Smp_061230
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Smp_061230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 8348152
NCBI-ProteinID: XP_018646201
GeneDB: Smp_061230
UniProt: G4LY63
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MVHLALSLNAIRKATKLNYLTNIYQSFKCRNLSYTSGYTIIDHSFDAVVVGAGGAGLRAG
FGLANEGFKTAIITKLFPTRSHTVAAQGGINAALGNMEPDDWRFHMYDTVKGSDWLGDQD
AIHYMCEEAPKAVIELENYGVPFSRLENGKIYQRAFGGQSIDYGRGGQAHRCCAVADRTG
HSLLHTLYGRSLRYDATYFIEYFVLDLLMENGECRGVIAVCLEDGTLHRFRSKNTVLATG
GYGRTYFSCTSAHTCTGDGTAMVTRAGLPNQDMEFVQFHPTGIYGAGCLITEGCRGEGGY
LINSKGERFMERYAPNAKDLASRDVVSRAMTIEIREGRGVGPRKDHIFLQLSHLPADQLH
SRLPGISETAKIFAGVDVTRDPIPVLPTVHYNMGGIPTNYKGQVLAYDPVAKKGKVVPGL
YAAGEAASASVHGANRLGANSLLDIVVFGRACALDIAAKNKPGDAGPELKPDTGEASIAN
YEKLRTANGSYPIAQVRLDMQRTMQEYAAVFRDGPTLKEGCKKMYDLYASRMNDLKVSDR
SKIWNSDLMEALELQNLMLNALQTIVGAEARKESRGAHAREDFPNRVDELDYSKPIDGQK
PKPFEEHWRKHTLSYQDVKTGAVKLEYRPVIDATLDAKSCPSVPPKLRTY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctggcactttctctaaatgccatccgtaaagctacgaagttgaactattta
accaatatataccagtcttttaaatgtcggaaccttagttacactagcggatacactatt
attgaccattcattcgatgcggtggttgttggtgcaggtggggcgggtttgcgtgcaggt
ttcggcctcgcaaatgagggtttcaaaactgcaattataacaaaattatttccgaccaga
tctcacactgttgctgctcaaggagggataaatgctgctctcgggaatatggaacctgat
gactggcgtttccatatgtatgacacagtcaaaggttccgattggttaggtgaccaggat
gctattcattacatgtgtgaagaagccccaaaagccgttatcgagttggaaaactatgga
gtaccttttagtcgcctggagaacggtaaaatataccagcgagcatttggtggtcaaagt
atagactatgggcgcggtggtcaggcccatcgctgttgtgcagttgcggatcggactggg
cattcacttttgcatacattatatggccggtcattacgttatgacgccacttactttatt
gaatatttcgtattggatcttctcatggaaaatggagagtgtcggggtgtcattgctgtg
tgtttagaggatgggactttgcatcgtttccgttctaaaaatacggttcttgctacaggg
ggttatggtcgtacatacttttcctgtacttcagcacatacttgcacaggtgatgggacg
gcaatggtcacacgggctgggttgcctaaccaagacatggagtttgttcagtttcatccc
acaggaatttatggggctggatgcttaatcaccgagggctgtcgaggcgaaggtggttac
ctcattaatagtaaaggagagagatttatggagagatatgctcctaatgctaaagatttg
gcttctcgggacgttgtgtcaagagcaatgacgattgagattcgcgaaggacgaggagtt
ggtcctaggaaagatcacatatttttacaactttctcatcttccggcggatcaattgcac
agtcgacttcctggtatatcagagacagcaaaaatattcgcaggtgttgatgttacaagg
gatcccattccagtgttaccaaccgtccactataatatgggtggaatccctacaaactat
aaaggacaggtgttggcatatgatccggttgctaagaaaggtaaggttgttcctggactg
tatgctgctggcgaagctgcttccgcatcggttcacggcgctaatagactaggtgccaac
tcactacttgacattgttgtatttggtcgtgcatgtgcgcttgacattgctgcaaaaaat
aagcctggagatgcaggtccagagttaaaaccagatactggagaggcctccatcgctaac
tatgaaaaactccggaccgcaaatggaagttatccaattgcacaagttcggttagacatg
cagcgaacaatgcaagagtatgctgcagtatttcgtgatggtcctactctcaaagagggc
tgtaaaaaaatgtatgatttatatgcttctcgaatgaatgatttaaaagttagtgatcgc
agtaaaatatggaatagtgatctaatggaagcattagaattacagaatctgatgctaaat
gctttacagactattgttggagctgaagcccgtaaagaatcgcgtggtgctcatgcacgt
gaagattttcctaatcgagtagatgaattagactactctaaacctattgatggacaaaaa
cccaagccatttgaagaacattggcgaaaacatactctatcttatcaggatgttaaaact
ggtgctgtaaaattggaatatcgtcctgtaattgatgccaccttggatgctaagagctgt
ccatctgtccctccaaaactacgcacttattag

DBGET integrated database retrieval system