KEGG   Schistosoma mansoni: Smp_089640.2Help
Entry
Smp_089640.2      CDS       T01095                                 

Definition
(RefSeq) putative succinate dehydrogenase iron-sulfur protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
smm  Schistosoma mansoni
Pathway
smm00020  Citrate cycle (TCA cycle)
smm00190  Oxidative phosphorylation
smm01100  Metabolic pathways
smm01200  Carbon metabolism
Module
smm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smp_089640.2
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Smp_089640.2
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Smp_089640.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_9 Fer4_16
Motif
Other DBs
NCBI-GeneID: 8355787
NCBI-ProteinID: XP_018647532
GeneDB: Smp_089640.2
UniProt: G4V5U3
LinkDB All DBs
Position
1
AA seq 277 aa AA seqDB search
MWKSLTFSLSSFSLARCASTATGSAPRMKTFSIYRWNPDKRGEKPTMQNYQVDLNDCGPM
VLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIEGRNHLACIWEIDPDINKTTKIYPLP
HMYVIKDLIPDMNNFYAQYRFIEPYLKKKNVDEEDIGKKTYYQSVEDRAKLDGLYECILC
ACCSTSCPSYWWNGDKYLGPAVLLQAYRWLVDSRDDYTYERLAEFQNKWSLYRCHTIMNC
TETCPKGLNPGLAIGEIKKMLIYFNQYKHKKPETRTV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatccctgactttttcgctatcatctttcagtctcgctcgttgcgcttcaact
gcgacgggatcagctccacgtatgaaaaccttttccatttacagatggaaccccgataaa
cgtggcgaaaaacccaccatgcaaaactatcaagtcgatctcaatgattgtggacctatg
gtcttggatgctttaatcaagataaagaatgaacaagatcctaccctgacatttcgacgt
tcttgccgtgaggggatatgtggttcttgtgcaatgaatatagagggtcgtaatcacctt
gcctgtatatgggaaatagatccagatatcaacaagacaactaaaatatatccattgcct
catatgtatgtaattaaggatctaattccagatatgaataatttttatgctcagtaccgt
tttattgagccttatttaaagaaaaagaatgtggatgaagaagatattggaaagaagact
tattatcagtcagtagaagacagagcaaagctagatgggctttatgaatgcattctgtgt
gcttgttgttctacttcatgtccatcttattggtggaatggtgataagtatttgggtccc
gctgttctgcttcaggcttacagatggttagtcgattcacgtgatgattatacgtatgaa
cgtttggctgagttccaaaacaagtggtcactttatcgatgtcatactattatgaattgc
acagaaacatgcccaaaaggattgaatcctggtttggctattggagagattaagaaaatg
ctaatctatttcaatcagtataaacacaagaaaccggagacgagaactgtttag

DBGET integrated database retrieval system