KEGG   Schistosoma mansoni: Smp_133210Help
Entry
Smp_133210        CDS       T01095                                 

Definition
(RefSeq) putative alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
smm  Schistosoma mansoni
Pathway
smm00052  Galactose metabolism
smm00500  Starch and sucrose metabolism
smm01100  Metabolic pathways
smm04142  Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Smp_133210
   00500 Starch and sucrose metabolism
    Smp_133210
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Smp_133210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smm04147]
    Smp_133210
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Smp_133210
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_133210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 8353098
NCBI-ProteinID: XP_018647945
GeneDB: Smp_133210
UniProt: G4V8C5
LinkDB All DBs
Position
1
AA seq 903 aa AA seqDB search
MGKCEIVHSIGNVRHLHDESLMSIQCEKISQVERLDCHPEQHATRSECESRGCCWIPKSA
LDDDGLPMCFFPKSYPTYQIYSSQKTERGSIVQLYKSNPKYYRNEIKNISFEVRQETSTR
LRLRFTIPSQLNRWEPSLPLGRLEDTPIANVQYNVSMESSPFGLKIMRNNQKQDVILDST
GSLTSSLIISNQFLQITFHVNAQKGFGPGEIEKVFPNPLNKWMRLGFWSHDGIPQPNSNL
YGTHNFFMGLKYDGTAFGIFFLNSNAQEVAITPLPAITYRTIGGILDFFVFTGPKPLDVI
NQYYDHIGHPPIPPYWSLGFHICRYGMKNLDEAKEVLKRNVDAGIPIDAQWFDIDYMDAY
KIWSVDTKRFGGIDVYVRDVLRKKYSVRTVLIIDPAVSTKGGTGYRPYEDGMRHGIFIND
SRTGTPILGTVWPGETVFPDFSHPSAEDWWFKSASDFHKVINFDGLWIDMNEPANFNSGS
LSGCPSSNTLDNPPYVPKILGNSLYDKTICPSALHYNTTHYNMHNIYGYDMARVTHNVLT
RMFPDKRPFILTRSSFAGSGLYAAHWTGDVLSNWDSLKTSVVQIINFNMFGIPMVGADIC
GFTGNTTEELCIRWSQLGAFYPFARNHNAHGSNNQDPACWSEETTIAIKQAIRLRYHLLP
YMYTLFYRSYLNGTTVARALAFEFPEDLATHKVNAQFMLGSCILVTPVLDEGRTFVEGYV
PSGEWINLSSGKRYFSRGTWKYFDAPLNVIPISIRCGCIIPMQVSAETTDIARKKGFGLF
VILSSTDDGSDAAGQRITASGELFWDNGDDGNLNYVHVKFEVRDRTLTVTSTPSSVGSLE
KIDFQELDVKQIFIVGLSKIPSEIMLNNNPLKFTYHHNEQTCHLTSQYYMTLSKDFTIKW
IFN
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatgtgagattgttcattcgattggaaatgttcgtcatcttcatgatgaatcg
ttaatgagtatccaatgtgaaaaaatttcccaagttgaacgtttagattgtcatcctgaa
caacatgcaactcgtagtgaatgcgaatctcgaggttgctgttggattccaaaatctgca
ttagatgatgatggattaccaatgtgtttttttccaaaatcctatccaacttatcaaatt
tattcaagtcaaaagactgaacgtggttctattgttcaattgtataagtcaaatccaaaa
tattatcgaaatgaaataaaaaatatttcatttgaagtgagacaagaaacatcaactagg
ctacgtttacgatttactataccatcacaactaaatagatgggaaccatctctaccgtta
ggacgattagaagatactccaatagcaaatgttcaatataatgtttcgatggagagttca
ccttttggattgaaaatcatgcgaaacaatcaaaaacaagatgtgattctggattccaca
ggttcacttacttcatctctaattatttcaaatcaattcttacaaataacattccatgtg
aatgcacaaaaaggctttggtcctggagaaattgagaaagtatttccaaatccattaaac
aagtggatgcgcttaggattttggtcacatgatgggatacctcagcccaattcaaatctt
tatggaactcacaatttcttcatgggtttaaagtatgatggcacagcatttggaatcttc
tttttaaacagcaacgctcaagaagtagcaataacacctctaccagccatcacatataga
actattggtggcattttagatttcttcgtattcactggaccgaaaccactagacgtgata
aatcaatattatgatcatatcggtcatccaccgatacccccatattggtcactcggattt
catatctgtagatatggaatgaaaaatctggatgaagccaaagaagtcctcaagcgaaat
gtggatgctgggattccgatagatgctcagtggtttgatattgattatatggatgcatac
aaaatttggtcagtggacacaaaacgatttggtgggatagatgtttatgttagggatgtt
ttacgtaagaagtatagtgtgagaacagtgttgatcatagatccagctgtcagcacgaaa
ggtggtactggatatcgtccatatgaggatggtatgagacacggtattttcattaatgat
agtcgaactggaacaccgattctaggtaccgtgtggccaggtgaaacagttttcccagat
ttctcacacccatctgctgaggattggtggttcaagtcggcgtccgatttccataaagtg
atcaacttcgatggtttgtggatagacatgaacgaaccagccaatttcaatagtggatca
ctcagtggttgtccatcatcgaatacgcttgacaatcctccttatgtcccaaaaatcctc
ggaaactctttatacgataagacgatctgtccatcggccttacattacaacacaacacac
tataatatgcataatatatatggttatgatatggcacgtgtaacccacaatgttttgact
cgaatgtttcctgataaacgacctttcatattgacgcgttcaagttttgctggttcaggt
ttatatgccgctcactggacaggagatgttttatcgaattgggatagtttgaaaacttct
gtggttcaaatcattaactttaatatgtttggtattcctatggttggtgctgatatatgt
ggatttacaggaaatacaacagaggagctgtgtatccggtggagtcagttaggtgcattt
tatccgtttgctcgaaatcataatgcacatggttcaaacaatcaagaccctgcatgttgg
agtgaagaaacgactatagctataaaacaggctatccgtctaagataccacctactgccc
tatatgtacactttgttctatagatcatacttaaatggaacaactgtggctcgtgccctc
gcattcgagttccctgaagacttggccacacataaagtcaatgcacaattcatgctcgga
tcgtgcatcttagtcactccagtgctcgatgagggtcgtacattcgttgagggttacgtt
ccgtcaggagaatggattaacctatccagtggcaaacgatattttagtcgaggtacttgg
aaatatttcgatgctcctttgaatgtcattccgatttctattcgttgtggttgtataatt
ccaatgcaagtttctgctgaaacaacagatatcgctcgtaagaaaggattcggtttattt
gtgattttgtcttcaactgatgatggaagtgatgctgctggtcagaggatcacagcatca
ggtgaattattctgggataatggagatgatggtaatttaaattatgtacacgtcaaattt
gaagtacgtgatcgtactttgacagtgacttctacaccttcgagtgttggaagcttagag
aaaattgattttcaagaactggacgttaaacagatttttattgtcggcctcagtaaaatc
cccagtgaaattatgttgaacaataatccattgaaatttacatatcatcataatgagcag
acttgtcatctaactagtcaatattatatgacactatctaaagacttcactattaaatgg
atttttaattga

DBGET integrated database retrieval system