KEGG   Schistosoma mansoni: Smp_156550Help
Entry
Smp_156550        CDS       T01095                                 

Definition
(RefSeq) alpha-amylase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
smm  Schistosoma mansoni
Pathway
smm00052  Galactose metabolism
smm00500  Starch and sucrose metabolism
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Smp_156550
   00500 Starch and sucrose metabolism
    Smp_156550
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Smp_156550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase CrgA
Motif
Other DBs
NCBI-GeneID: 8355883
NCBI-ProteinID: XP_018647154
GeneDB: Smp_156550
UniProt: G4M0Y9
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MKNFKNNFKSPRERLLEEIRKRVPVEPDSEDENNQSISDTSTSFEKISQVESCSELTNLD
ETHSTWKYIVIVLSTVVSLLCLGLLVWLTLYITGWRKSTPISKLPFWNSEVGYWVDVFAF
KDSNGDLVGDLNGFLSEVNYIKGVIGSGFVILGPITKGFYSNPHNMIGLVEDYEELDEAV
GTINDFRHLLRRFHEKDLKVVLTFDFNSVSIDHKWIKEDRIKPKLFDNSLKNKISRYGKS
PSVDIYAQKYYSVFGSPSVDLDLTDINTQNAIFDVVHYWMREGIDGILLDNAAYFVEQEE
RQETQKKVELLGVNAGDTWCDLTGRPDPMLIFREVADVIIIREFLPNRGCKENFPTTKNL
TCKYHSYQDAYKQKLGLTVSTSSFPSRKDVLSLAASLLLPGIPIIYYGAELGMASLNRGR
RPEKLYPQGKSYHNEDLLDYGSILSHQPMPWDTSGQRFSGAINDSSFKDYVKKNIKSEVV
ENVVGRQCEQTVYDLVQRLINLRQNPTFKSGTMEELSSFKDYEKYYYGVFVRRAPGFPTF
VIVLMRYTTSNFVLDFRYICSSVSVRLVYPSIPNLPANNELRCPEIHIVNRTLSNQIIVL
QCN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattttaaaaataattttaagtccccaagagaaaggctgttggaagaaatacgc
aaacgcgtaccggttgaaccagattcggaagatgaaaataatcaatcaataagtgacaca
tcaacgtcatttgagaagatatctcaggtggagagttgttcagaactaacgaatttagat
gaaactcattcaacatggaaatacattgtgattgtattatctactgtcgtatctttatta
tgccttggcctattggtttggttgactctttacataactggttggaggaaatccacacct
atatcgaaattaccgttctggaactctgaagttggctactgggtagatgtatttgctttc
aaagattccaatggggatttagttggcgatctaaatggttttttatctgaagtgaattat
ataaaaggtgtgattggttcgggatttgtgattttgggccctatcacaaaaggattctat
agtaatccacataatatgatcggattggtagaggattatgaggagttagatgaggcagtt
ggtacaataaacgattttcgtcatctcctaagacgatttcatgagaaggatttgaaggtt
gttttgactttcgatttcaattcagtatctatcgatcataagtggatcaaagaagaccgt
atcaaaccaaaattattcgacaatagtttaaagaataaaatatcaagatatggaaaatca
cccagtgtagatatctatgctcagaagtattattcggtattcggatcaccgagtgtagac
cttgatttgactgatattaacactcagaatgccatatttgatgttgttcattattggatg
agagagggaattgacggaattctgctagacaacgctgcatattttgttgaacaagaggag
cgacaagaaacacaaaagaaggtagaattactgggtgtaaacgcaggagatacgtggtgt
gatttgaccggcagacctgatccaatgttgatctttcgagaagtagcagatgtgataatc
atccgtgaatttttaccaaacaggggttgtaaagaaaactttcctacaacgaagaaccta
acatgcaagtatcacagttaccaagatgcttataagcagaagttagggttaactgtatcc
acttcaagcttcccctccagaaaagacgtgctgtccctagctgcctcattattattacca
ggaatacctataatttattatggagctgagcttggtatggctagtttaaatagaggacgt
cgaccagaaaagttgtatccacaaggaaaaagctaccataatgaggatctactcgattat
ggttcaatactatctcaccaaccaatgccatgggatacaagtggacagagattttcagga
gcaataaacgattccagcttcaaagattacgtgaaaaaaaatattaaaagtgaggttgta
gagaatgtagttggtagacaatgcgaacaaacggtttacgatctcgttcaaagactgatc
aatttgcgtcaaaatccgaccttcaaatcgggaacaatggaggaactaagcagctttaaa
gattatgaaaagtactactatggtgtattcgtacgaagagctccaggttttcctacattc
gtcattgtactaatgcgatacacaacatctaacttcgttctggacttcagatatatttgt
tcttcagttagtgttcgactggtatatccttcgattccaaatttaccggctaataatgaa
ctgcggtgtcctgaaatacatattgttaaccgtacgttaagtaatcaaattatagtactt
caatgtaactga

DBGET integrated database retrieval system