KEGG   Schistosoma mansoni: Smp_169230Help
Entry
Smp_169230        CDS       T01095                                 

Definition
(RefSeq) tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smm01001]
    Smp_169230
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Smp_169230
Protein kinases [BR:smm01001]
 Non-receptor tyrosine kinases
  ABL family
   Smp_169230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 8347709
NCBI-ProteinID: XP_018650853
GeneDB: Smp_169230
UniProt: G4VGW8
LinkDB All DBs
Position
3
AA seq 1194 aa AA seqDB search
MRYNELIVVFAKLILLTLPKGNNQFQHYWLASCGQYGDVYEAVWKRFNSVVAVKTLKQDV
NLNVNDFLKEAAIMKKLRNRNLVQLLGVCTREPPLYLITEYMPNGNLLNYLRTRSPGELT
PLTLLYMAVQIASGMAYLEANNFIHRDLAARNCLVGDQHLIKVADFGLARYMQRQDTYTA
RNGAKFPIKWTAPEGLSYYLFSSKSDVWAFGVVLWELATYGLSPYPGVELHDVYHLLEKG
YRMERPHGCPEAVYSIMLRCWSWDPNLRPSFSEIHAELEQMYTTMNIEAEVALELGKQPA
NFIPQQQQQPLVSSNRFTEIQPHDLQGNSVNQFNMVFKESLPSSVIPTEIVNSDHIISRH
NNAIHSTSNIDFTCNATESSRPNPVSSYVIMNSVANHSIHHHVENNIASLNNNIHNCMKK
EKTIFIDQNRLSKDKHSVLPYPSSSGGGFKQENYRLRKPVISLDPQMTSIHESSQNGFSN
LIQCRTPFSSNYLTQTQYSPASLSDNGFLPFGEKLCYFIPMSNNPSYQPNSHITSSNITQ
NCGISNLSQFSNNNPASIVSKIPNLNVANSTKVVNDRSAIRTNRSIHRNVTSGCNTQTSS
QQNGTTRSQDTDTPDESGVGESIISNESPAESRACGGGIMSNAAGVGVIATMNSILSSAP
SQVDWHFNVPFEVSMPIDDHSQHFHHAQIITPTSNSVIHHPHSYPYLFQTTNTSTTRITT
TTINTTTTHISSASSTQFNVNPLMEQFSTIPPHDRIGSYLKSLGELDTGCGRHHRCNEPP
TFTYHQSQPNELHLPTDILDVNDKTFNHPSNVLHYPPPPPPVPPPPHSSIMECCNPPSLP
PTSTTNNASIQLSSDVTSTGEISKSNISQPISPVLRSKQYFHSKAITDSETGTNMDQPTN
CFSSNNQNLSQLKASSEQNNIAVDESSLNHNNSNSNNSDIKDLHSNTSYSKISQPRRRIK
VDTERAVSGNAGHLDYPGVGRRHLPLDDRSEEESNTEEVPRSLEDETLSIASDSPNNSQD
NSMSIKPDADLSGGGEGDDVYQAPDSYYLPNINNSNSQNLQPNSTSQESITNLLERTIEL
VNWTKDLCSYCEMEYEIPNASFIELSNCLDSFRIELEAYIVEHISINPDLTKTILILCDN
LGKQTTNLSLHLKTMEVDKPAFSVHCNSCHSCLKEIHEHIVQLLNKSKVTNANY
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacaacgaactcattgtagtttttgcaaagcttattcttcttactttaccaaag
ggtaacaatcagtttcagcactactggttagctagctgtggtcaatatggtgatgtatat
gaagctgtttggaaacgtttcaattctgttgttgcagtaaaaacactgaaacaagatgtt
aatctgaatgtgaatgattttctcaaagaagctgctattatgaagaagttacgtaataga
aatttagttcaattattgggcgtatgtactcgagaaccgcccctttacttaattacggaa
tatatgccaaatgggaatttattgaattatttacgtacacgtagtccaggtgaactcacc
ccgcttactctactttacatggctgttcaaatcgcctctggtatggcgtatttagaagct
aataattttatccacagggatttagctgctagaaattgtttagtaggtgatcaacatttg
atcaaagttgcagattttggtttagcacgttacatgcaacgacaagatacttatactgct
cgtaatggtgctaaattccctattaaatggactgctcctgaaggtctttcttactatttg
ttctcgtcaaagtcggatgtatgggcttttggtgtagtcctatgggaactagccacctat
ggtctttcaccttatcctggagttgaattgcatgatgtttatcatcttttagagaaaggc
tacagaatggaacggccacatggatgcccagaagcagtttattctataatgttaagatgc
tggtcttgggatcctaatttacgtccttcattcagtgaaatccatgcggaactggaacaa
atgtatacaactatgaacatagaagctgaagttgctttggaattgggaaaacaacctgct
aattttatcccacaacaacaacaacaaccacttgtcagttcaaacagattcacagaaata
caaccacatgatttacaaggcaattcagtaaatcaatttaatatggtcttcaaggagtct
ttaccaagtagtgttataccaacagaaattgtgaattcggatcacatcatttctagacat
aataatgctattcattccacttcgaatatagatttcacctgtaatgcaactgaatcaagt
cgaccgaatccagtatcttcttatgttataatgaattctgttgctaatcactcaatacat
catcatgttgaaaataatattgcttcacttaataacaatattcataattgtatgaaaaaa
gaaaagactatatttattgatcagaatcgtttgtccaaagataaacattcagttcttcct
tatccttcatcgtctggcggtgggtttaaacaagagaattatcgtcttcgaaaacctgtt
attagtttagacccacaaatgacatccatacatgaatctagtcagaatggattttctaat
ttgattcaatgtcgaacaccattttcatcaaattatttaacacaaacccagtattcaccg
gcttcgttatctgataatggatttttacctttcggtgaaaaattatgttactttatcccg
atgagtaataatccatcttatcaaccgaattcacacattacgtcatcaaatattactcaa
aattgtggtatttcaaatctttctcaattttccaataataatccagcttccatagtttct
aaaattcctaacttaaatgttgctaattcaacaaaagtagtgaatgatcgatcggctatt
cggacgaatcgttctattcatcgtaatgttacttctggctgtaatactcaaactagttcg
caacaaaatggtacaacacgtagtcaagacactgatacaccagatgaaagcggcgttggt
gagtcgattatttcaaatgaatcacctgcagaaagtcgagcatgcggtggtgggataatg
agtaatgctgccggtgttggtgtaattgctactatgaattcgatattatcaagtgcacct
agtcaagttgattggcattttaatgtgccgtttgaagtgtccatgccaattgatgatcat
tctcaacatttccaccatgcacaaataataactcctacttcaaattctgttattcaccat
ccacattcctatccatacttatttcaaactactaatacttctacaacaagaataacaact
actactatcaataccacaactactcatatttcttctgcctcatctactcaatttaatgtt
aatccactaatggaacaattctctacaataccacctcatgataggattggaagttattta
aaaagtttgggtgaattagataccggttgtggtcgtcatcatcgttgtaacgaaccacca
acatttacttatcaccaatcacaaccaaatgaattacatttaccaactgatatacttgat
gtaaatgataaaacatttaatcatccatcaaacgttttacattatcccccaccaccacca
ccggtgcctcccccacctcattcatcaataatggaatgctgcaatccaccgtcgttacct
cctacctctactaccaataatgcttcaattcaattaagttcggatgtaacttcaactggg
gaaatttcaaagtcaaatatttctcagccgatttctcctgtactacgtagtaagcaatac
ttccattcaaaagcaataacagatagtgaaactggaacaaatatggaccaaccaaccaac
tgtttttcatctaacaatcaaaatttatctcaattgaaagcttcatctgaacagaataac
atagctgttgatgaatcttctttgaatcataataacagtaatagcaataatagtgatatt
aaagatctgcattctaatacctcttattcaaagatttctcagccacgccgacgtattaaa
gtagatacagaacgtgctgttagtggtaatgctggacacctggactatccaggagtaggg
cgacgtcatttaccactggatgatcgatcagaagaggaatcgaatacggaagaggtgcca
aggtcattggaggatgagactttatccatcgcgtctgactctccgaacaattctcaagat
aattcaatgtcaattaaacccgatgcagacctgtcaggtggtggtgaaggagatgatgtt
taccaggcgccagactcttactatttaccaaatattaataattcgaattcacaaaattta
caacccaattctacttcacaggaatcaattacaaatcttcttgaacgaactattgaatta
gtcaattggactaaagatctatgtagttattgtgaaatggaatatgagatcccgaatgca
tcgttcattgaactatcgaactgtttagattcttttcgtattgaattagaagcctatatt
gtggaacatataagtattaatccagatcttactaaaactatcctaattttatgtgataat
ttaggtaagcaaactacaaatttatctttgcatttaaagactatggaagttgataaacct
gcctttagtgtacattgtaattcttgtcattcgtgtttaaaagaaatccatgaacatatc
gtacaacttttaaataagtcaaaagtaaccaatgcaaattattaa

DBGET integrated database retrieval system