KEGG   Schistosoma mansoni: Smp_176200.1Help
Entry
Smp_176200.1      CDS       T01095                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smm  Schistosoma mansoni
Pathway
smm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Smp_176200.1
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Smp_176200.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 8341912
NCBI-ProteinID: XP_018646947
GeneDB: Smp_176200.1
UniProt: Q01137 G4M0D0
LinkDB All DBs
Structure
PDB: 

Position
Unknown
AA seq 153 aa AA seqDB search
MKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAG
AHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRTMVIHE
NEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtttgtgttatgactggtacagctggcgtaaaaggtgttgtcaaatttact
caagaaactgataacggacctgttcatgttcacgccgaattcagtggactcaaggctggt
aaacatggctttcatgttcatgaatttggtgatacaacaaatggatgtacttcagctgga
gctcatttcaatccaactaaacaagaacatggagcaccagaagatagtattcgtcatgtt
ggtgacctgggaaatgttgtggcgggtgctgatggaaacgcagtttataacgcgactgac
aaattaatatctttgaacggctctcattcaatcattggtcgaactatggttatccatgaa
aatgaagatgatttaggccgtggtggtcatgagctcagcaaagtaactggtaatgctggt
ggtcgtttagcttgtggcgttgttggtttagctgctgagtag

DBGET integrated database retrieval system