KEGG   Schistosoma mansoni: Smp_205760Help
Entry
Smp_205760        CDS       T01095                                 

Definition
(RefSeq) unnamed protein product
  KO
K04546  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:smm04031]
    Smp_205760
GTP-binding proteins [BR:smm04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    Smp_205760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 29830829
NCBI-ProteinID: XP_018644771
GeneDB: Smp_205760
UniProt: G4M241
LinkDB All DBs
Position
Unknown
AA seq 66 aa AA seqDB search
MSTLSQQRKLVEQLRQEANLNRRPVSECVQEMIVYMEQNRDKDCLFSGFASKKDNPFQEK
GGCVVI
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactttaagtcaacaacgtaaactagttgaacaattacgtcaagaagcaaattta
aatcgtcgtcctgtctctgaatgtgtacaagaaatgattgtgtatatggaacagaatcgt
gataaagattgtttattttcaggatttgctagtaaaaaagataatccattccaagaaaaa
ggtggatgtgtggtgatttag

DBGET integrated database retrieval system