KEGG   Streptococcus macedonicus: SMA_0972Help
Entry
SMA_0972          CDS       T01674                                 

Gene name
amyA
Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smn  Streptococcus macedonicus
Pathway
smn00500  Starch and sucrose metabolism
smn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMA_0972 (amyA)
Enzymes [BR:smn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SMA_0972 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CCF02263
UniProt: H2A6A5
LinkDB All DBs
Position
complement(957090..958544)
Genome map
AA seq 484 aa AA seqDB search
MTNETLMQYFEWYLPNDGKHWQRLAADAPELAQKGISKIWLPPAFKATHAGDVGYGVYDL
FDLGEFDQKGTIRTKYGTKADYLAAIASLKENGIEPLADVILNHKAAADHTEIFTVVEVS
PEDRTKVLGEPFEIEGWTNFTFAGRHKTYNDFEWHWYHFTGIDYDVKTGKTGIFKILGDN
KGWANQDLVDGENGNYDYLMYADLDFKHPEVIKNIYDWADWFVQTTGIAGFRLDAIKHID
SFFMGNFIRDMKLKYGDDFYVFGEFWNGDEQSNNNYLENTDYRFDLVDVRLHQNLFEASQ
EMETYDLRTIFDQTLVKNHPDSAVTFVDNHDTQRGQALESTIAAWFKPAAYALILLRQTG
LPCIFYGDYYGISGEFAQENFKKEIDQLLQLRQTAVYGQEEDYFDDPNCIAWTCLGDDEH
PTALATLISNANAASKRLFVGEKWANHIFTDVLENNQTEVTIDTQGYGVFPVNEKSVSAW
VPNH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaaactttgatgcaatattttgaatggtatttaccaaatgacgggaaacat
tggcaacgattagcagctgatgctcccgaactagctcaaaagggcatttctaaaatctgg
ttacctcctgcttttaaggctacacacgctggcgatgttggctatggtgtttatgacctt
ttcgacctcggagaatttgaccaaaaaggaacgattcgaaccaaatatggaactaaagcc
gattatcttgctgccattgctagcttaaaagaaaatggtattgagcccttagcggatgtg
attttgaatcacaaggcagcagctgaccacaccgaaatctttactgttgtcgaagtgtcg
ccagaggaccgcacaaaggttcttggtgagccttttgaaatcgaaggttggacaaatttt
acttttgcaggtcgacataaaacctataatgattttgagtggcactggtatcattttaca
ggaatagattatgatgtcaaaactggaaaaactggaatttttaaaattctaggcgacaat
aaaggttgggcaaatcaagatttagttgacggtgaaaatgggaattatgactatctgatg
tatgctgatttggatttcaaacaccctgaagtcattaaaaacatttacgattgggcagat
tggtttgttcaaacaactggtatcgctggttttcgattagacgctatcaaacacattgat
tctttcttcatgggtaattttatccgtgatatgaaattaaaatacggcgacgatttctac
gtctttggtgaattttggaatggtgatgaacagtctaacaacaattacttggaaaatacc
gattatcgttttgatttggtagatgtccgccttcatcaaaatctctttgaagctagccaa
gaaatggaaacttatgatttgcggacaatttttgaccaaaccttggtcaagaatcaccca
gattctgccgttacttttgtcgataaccatgatacacaacgtgggcaagctttggaatca
actattgcagcatggtttaagcctgctgcttacgctttgattctacttcgtcagactgga
ttgccttgtattttctatggtgattactacggtatttctggcgaatttgcacaagaaaat
ttcaaaaaagagattgaccaattattacagcttcgtcaaacagctgtctatggacaggaa
gaagattactttgatgaccccaattgcattgcgtggacttgtcttggggatgatgaacac
cccacagcactagctacactcatcagtaatgctaacgctgcttcaaaacgcttatttgtt
ggcgagaaatgggctaaccacatttttacagatgtcttagaaaataatcagaccgaggtc
accattgatacgcaaggttatggcgtttttcctgttaatgaaaaatctgtcagcgcgtgg
gtgccaaatcactaa

DBGET integrated database retrieval system