KEGG   Streptococcus macedonicus: SMA_1458Help
Entry
SMA_1458          CDS       T01674                                 

Definition
(GenBank) putative amidotransferase similar to cobyric acid synthase
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
smn  Streptococcus macedonicus
Pathway
smn00550  Peptidoglycan biosynthesis
smn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMA_1458
Enzymes [BR:smn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SMA_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 DJ-1_PfpI GATase_5 GATase
Motif
Other DBs
NCBI-ProteinID: CCF02749
UniProt: H2A7L3
LinkDB All DBs
Position
1433036..1433824
Genome map
AA seq 262 aa AA seqDB search
MTYTSLQSPNTKDYNYELNVAHLYGNLMNTYGDNGNILMMKYVGEKLGAKMTFDIVSLGD
TFDADYYDMVFFGGGQDYEQTIVAKDLPSKKEAIADFINKDKVILAICGGFQLLGQYYVQ
ANGEKINGIGVMGHYTLNQENNRFIGDIKIHNDEFNETYYGFENHQGRTFLSDDEKPLGI
CVYGNGNNKEDGTEGVHYKNVYGSYFHGPILSRNANLAYRLVTTALKNKYGSSITLPSYD
DILSKEVAEEYADTKSKAEFEK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacttcgctacaatctcctaacacaaaagattacaactatgagttaaacgtt
gcccacctttacggcaatctgatgaatacctatggtgacaatggtaatatcctcatgatg
aaatatgtcggtgaaaagcttggagctaaaatgacctttgacattgtttcattaggggat
acctttgacgctgattactacgatatggttttctttggtggtggtcaagactatgaacaa
actattgtcgccaaagaccttccaagtaagaaagaagccattgctgacttcatcaacaaa
gacaaagtcattctagctatctgtggtggtttccaactccttggtcaatactatgttcaa
gccaatggtgaaaaaatcaatggtattggtgttatggggcattacaccctcaatcaagaa
aacaatcgtttcatcggagatatcaaaattcataacgatgaatttaacgaaacttactat
gggtttgaaaatcaccaaggtcgaacattcttgtctgatgacgaaaaaccacttggtatc
tgtgtttacggaaatggtaataacaaagaggacggcactgaaggtgttcattataaaaat
gtctatggcagctacttccacggacctatcctctcacgtaatgccaaccttgcttaccgc
ctagtgacaacagctctaaaaaataaatacggttctagtattacactaccaagttacgat
gacattctttcaaaagaagtcgccgaagaatatgccgatactaaaagtaaagctgaattt
gaaaaataa

DBGET integrated database retrieval system