KEGG   Selaginella moellendorffii: SELMODRAFT_110614Help
Entry
SELMODRAFT_110614 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smo01009]
    SELMODRAFT_110614
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:smo03019]
    SELMODRAFT_110614
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_110614
   03036 Chromosome and associated proteins [BR:smo03036]
    SELMODRAFT_110614
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SELMODRAFT_110614
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELMODRAFT_110614
Messenger RNA biogenesis [BR:smo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     SELMODRAFT_110614
Membrane trafficking [BR:smo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    SELMODRAFT_110614
Chromosome and associated proteins [BR:smo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     SELMODRAFT_110614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 9660401
NCBI-ProteinID: XP_002979356
JGI: 110614
UniProt: D8S7J7
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
RAMAVGLVYDRRMCAHRDPFNKLHPEQPARITAIWKRLEDAGVLDRCVRVDARPATAEEL
ATVHTDRHIEKMSSVSSRAYGKEGRAALARRYNSIYFNDGSSESALLAAGSVVELSLKVA
RGELASAAAIVRPPGHHAEADEAMGFCLFNNVAVAAQILSSGKVSVAGSHKVLIVDWDVH
HGNGTQNMFWQDPNVLYFSVHRYDDGYFYPGGQEGNFDKVGGGAGAGFNINVPWPRGGYS
DADYVAVWEHVLMPVAREFNPDIVLISGGFDSARGDPLGGCKLTPLGYSIMTQELMQLAG
GKIVLALEGGYNLESIAESYLACVQVLLGDIQSERHDIERAYESTWTIIDKVRQELCQYW
PVLREKIEMPASRSSPPKAFERLTTEADAVEETHDGEVFVRSETVEIVQISVSSEVSSPH
SPSPYIWYATYGSNMWPARLMCYIQGGKVEGIEVPGQGLLEKTPPLEDFWLSAPHRLFFG
RERSLSWGNGGVAFLNPVPSDGDNCHLRAYKITLEQFNGILAQENRLDSMAASGLVSPSH
FETLKSSPHIVDFIENAWYGSVLYLGDKNGAPILTITCSQRDAKRFECGELPTRAPSVAY
QNTLINGLLEKGDLSHEQILAYVTSRAPRS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
agagcaatggcagtgggactggtgtatgatcggcgaatgtgcgcgcaccgcgatcctttc
aacaagctccatccggagcagccggcgaggattacagcgatctggaagcgcctcgaggat
gcaggcgtcttggacaggtgcgtgcgagtggatgcgaggccagcgacggcggaagagctc
gcgacagtccacacggacaggcacatcgagaagatgtcgtccgtgagcagcagagcttat
gggaaagaaggacgagcagctctcgcgaggcgctacaactcgatatatttcaacgatggc
tcgtcggaatcggcacttctagctgccggatccgtcgtggagctctctctcaaagttgct
cgaggagagctcgcgtcggccgctgctatagtgagaccacccgggcaccacgctgaagcg
gatgaagctatgggattctgcctatttaacaacgttgctgtagcagctcaaattctttca
tcgggaaaagtgagtgtggcggggtcgcacaaagtcttgatcgttgattgggatgttcac
catggaaatggaacccaaaacatgttttggcaagatcccaacgttttatacttctctgtc
cacagatatgacgatggatacttctaccctggaggtcaggaagggaatttcgataaagtt
ggaggaggtgccggtgcggggtttaatatcaatgtcccgtggcctcgtggtggatacagc
gacgcggattatgtcgctgtttgggagcacgtattgatgccagtggccagggagttcaat
cctgacatagttcttatatcgggaggtttcgattcagctcgaggagatccgttgggtggc
tgtaagcttacgccacttggttactcgatcatgacacaggaacttatgcaactggctgga
ggaaaaattgttctagcgcttgaaggaggctacaaccttgagtcgattgctgaatcgtat
ttggcatgcgttcaagttctacttggagatattcaaagcgagcgccacgacattgagcga
gcttacgagtctacatggactatcattgacaaggtccgacaggagctgtgtcaatactgg
cctgttctgcgtgaaaagatcgaaatgccggcttccagatcctctcctcccaaggctttc
gaaaggcttactaccgaggctgatgcagtcgaagaaacacacgatggtgaggtttttgtt
cgctcagaaactgtggagattgtccagatatcggtgagttctgaggtctctagtcctcac
agcccgagtccatacatatggtacgcaacttatggctctaatatgtggccagctcggttg
atgtgctacatccaaggtggcaaggtcgaaggtattgaagtgccaggacaaggtctactt
gaaaaaactccgccgctggaagacttttggctgtcagctccacatcgactattttttgga
cgagagagatctctttcgtggggcaatggaggcgttgcgttcctgaatccagtgccatct
gatggcgacaattgccatctccgagcatacaaaataacgttagaacagttcaatggtata
ctcgctcaagagaacaggctcgactcaatggcagctagcggcttggtttctccatcccac
tttgagacgctgaaaagttcacctcatattgtggacttcattgagaacgcgtggtatggc
agcgtgttatatcttggcgacaaaaatggagcgccgattctcacaatcacgtgctcgcaa
agagatgcaaaacgtttcgagtgtggggagcttcccacccgggctccttcggtggcgtat
caaaacactttaatcaatggcctacttgaaaagggagatctgtcacacgagcaaatcctc
gcgtacgtgacgtctcgagcaccaaggagctaa

DBGET integrated database retrieval system