KEGG   Selaginella moellendorffii: SELMODRAFT_111860Help
Entry
SELMODRAFT_111860 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
smo  Selaginella moellendorffii
Pathway
smo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    SELMODRAFT_111860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smo03036]
    SELMODRAFT_111860
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SELMODRAFT_111860
Chromosome and associated proteins [BR:smo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SELMODRAFT_111860
   Polycomb group proteins
    PRC2-EZH2 complex
     SELMODRAFT_111860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR WIYLD
Motif
Other DBs
NCBI-GeneID: 9649613
NCBI-ProteinID: XP_002980071
JGI: 111860
UniProt: D8S9D0
LinkDB All DBs
Position
Unknown
AA seq 820 aa AA seqDB search
MAALSATFTRLKKQVAFERQAYVKARMDANSERLQGFCTHLLALSSSRAVNNRNHADNDM
LNTRIQKALNKLGTDPAAADQQCGSQDDSSAPILFNNSGGKSIVKPVRLQTVQKTPPYTT
WIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEEEKRDFSKGDDFLIR
ATVQEHGSSKMVFKALADCLDAKPSEIEARYEILAKDGDKLKSEEKHDLLSAMDSFDNLF
CRRCLVFDCRLHGCSQPVIIPFDKQTPLNKTGELPSVPCGPCCFHLPRLSSHHDATSSGV
ESKPVPVESTAPAIEKSWQVPDSKDKGVATEPVAKTVDKPPEAPKKSFKDKSVTALRRLL
LKRKATRHTDDDTNEARKKHHVEGSHAEVGDGSGNATRGENTGASMYLKKLVSKKLYAQR
KWKGSQITTVKRPPPVIKESEDVMQSISKNLTLYDSNWNTLEKDLYETGLQIFGRDSCLI
SRNLLRGMKSCAEVGEFMQLEAAVNWKLNEETKLQQDGNTVIEDATIDRSRSRLYNGRRR
GRVRRLKYTWKSVGYPAIRKRLVDGKDGCRQYTPCSCSESCGKQCSCHRNGTCCEKYCGC
SKNCKNRFRGCHCAKSQCSSRQCPCFAAGRECDPDVCRNCWIGCGDGSQGGPPARGDSYE
CRNMKLLLKQQQRVLLGRSDVAGWGAFLKTPVNKHDYLGEYTGELISHREADKRGKIYDR
ENSSFLFNLNDQYVLDACRKGDKLKFANHSPNPNCYAKVIMVAGDHRVGIFAKERISAGE
ELFYDYRYEADRAPPWARKPEDGQKNDEAASGSGRAQKTA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggccgcattgtcggctacgttcacccggcttaagaagcaagtggcattcgagcgacaa
gcttatgtcaaggcaaggatggatgcaaactcggagagattgcaaggattttgtacgcac
ttactggcgctgtccagctcccgcgctgtgaataacaggaatcacgccgacaacgatatg
ctcaacacacggatccaaaaggcgctcaacaagcttgggactgatccagcagccgcggat
cagcagtgtggctcgcaagatgactcctcggctcctattcttttcaacaattccggtggg
aagagcattgtgaagcccgtcaggctgcaaaccgtgcaaaagacgccgccatatacaact
tggatcttcttggacaggaatcagcggatggccgaagatcaatccgtcgttggtcgaaga
aggatctattatgactctgctgaaaatgaagcgttgatatgcagtgacagtgaggaagaa
caagtcgaggaggaagaagagaaacgtgactttagcaaaggtgacgattttctcatcaga
gccactgtccaagaacatggatcgagtaaaatggtgttcaaggcgctagctgactgtctt
gatgcaaaaccgagcgagatagaggcacggtatgaaatactagcgaaggacggggacaaa
ctcaaaagcgaggaaaagcatgatcttctatctgcaatggactccttcgataatcttttc
tgtcgacgttgtttggtgttcgactgtcggcttcatggttgctcgcagccggtgataatt
cctttcgataagcagactccacttaacaagacgggggaactgccgtcagtaccatgcggt
ccctgctgtttccatttgccacgcctttcaagccaccacgatgccacttcttcaggcgta
gagtccaaacccgttcctgtagaaagcacagcacctgctattgagaagagctggcaagtt
ccggattccaaagacaagggcgtcgctacggaaccagtcgccaaaactgtggacaagcct
cctgaggctcctaagaagagcttcaaagataaaagtgtgaccgctctcagaaggttgcta
ctaaagaggaaagcgacgagacatacagacgatgacacaaatgaggcgcgtaagaaacac
catgtggaaggatcgcatgctgaggtgggagatggcagtggcaatgcgactcgcggcgag
aatactggggccagcatgtacttgaaaaaactggttagcaagaagctttacgctcagaga
aaatggaaaggaagccagatcaccactgtgaagcggccgccacctgtaatcaaggaatca
gaggatgtgatgcagagcatatccaagaaccttacgctatatgacagtaactggaacact
ttggagaaggacctttacgaaacagggctgcaaatctttggtagagacagctgtcttatt
tcaaggaatttgctaaggggaatgaagagctgtgccgaggttggggaattcatgcagctt
gaggcagccgtgaactggaagctgaatgaagaaacaaagctccaacaggatggaaacaca
gtcattgaggatgcgacgattgaccgttcgcggtccaggttgtacaacggacgcaggagg
ggacgtgtacgtaggctaaagtacacatggaaatccgtgggctatccagctatcaggaaa
agactcgtggatgggaaggatggctgtagacaatacacaccctgctcttgctcggagtcg
tgcggaaagcagtgttcttgccatcgaaatgggacgtgctgcgagaaatattgcgggtgc
tccaagaactgcaaaaaccgcttcaggggctgccattgcgctaaaagccagtgttccagt
cggcaatgcccgtgttttgcagctggacgggaatgtgatcctgatgtctgtagaaattgc
tggattgggtgcggggatggatcgcaaggcggaccaccggcacggggtgacagctacgaa
tgtcgaaacatgaaacttcttctaaagcaacaacagcgggttttacttggaagatctgat
gtcgctggctggggtgcatttttaaagacgccggtaaataagcatgactaccttggagaa
tacacgggagagcttatatcacatcgtgaagctgacaagcgtggcaagatttacgaccgc
gagaactcgtccttcttatttaatttgaatgatcagtacgtactggatgcctgccgcaag
ggtgacaagctcaaatttgcaaatcactcgccaaatccaaactgctatgcaaaggtgata
atggttgctggggatcacagagttggcatatttgcaaaggaacgtatatcagccggtgag
gaactgttctacgactacaggtacgaagccgatagagctcctccgtgggctagaaaaccc
gaagacggccagaagaatgacgaagccgcaagtggatccggtcgggctcagaagacagcc
tga

DBGET integrated database retrieval system