KEGG   Selaginella moellendorffii: SELMODRAFT_167184Help
Entry
SELMODRAFT_167184 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
smo  Selaginella moellendorffii
Pathway
smo00562  Inositol phosphate metabolism
smo01100  Metabolic pathways
smo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SELMODRAFT_167184
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SELMODRAFT_167184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smo01009]
    SELMODRAFT_167184
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SELMODRAFT_167184
    3.1.3.48  protein-tyrosine-phosphatase
     SELMODRAFT_167184
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     SELMODRAFT_167184
Protein phosphatases and associated proteins [BR:smo01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    SELMODRAFT_167184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase3 DSPc CDKN3 Y_phosphatase Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 9659934
NCBI-ProteinID: XP_002965143
JGI: 167184
UniProt: D8R200
LinkDB All DBs
Position
Unknown
AA seq 610 aa AA seqDB search
MESSPEAPVSVSVEPSEVPVEISVTEGAAAATQQRSKFYQRSASFFSRTAAATPGDGSTE
APSKLSVAGISTWAKSLKLPISPKDAKENSNASSPKDSKSPFSILSSGFGKRVPAKIPVV
DDELPTTTAPAQAQDGAFGTFTKGFLDSSRNAVKVVQTRARHLVSQNKRRYQEGGFDLDM
TYITDSIIAMGFPAGDMSSGILGYVEGFYRNHMEEVIRFFETQHKGKYKVYNLCSERLYD
VSLLEGKVASFPFDDHNCPPLQLVLAFCRSAYGWLKENLDNVVVVHCKAGKARTGLMISC
LLLYLKFFPTAEECIANYNERRCIDSKGLILPSQIRYVKYFERVLKEFNGETPAGRKCIL
RGIRLHRCPYWIRPAITVSDHNGILFSTKKHPRTKDMMPEDFWFSAPRRGIMVFALPGER
CVADLDGDFKILFQDRHGDFYCWLNTTMMETRQILNVADLDGFDKRRLPSPGFQVEVVIL
DPNASVPPVPPRESPPLPQAPQRSPDTESRENDDVFSDSEDGDSHRKENQAAAAAVVSSE
NRPKSSDSSPAAEEAPKARSDKDESSDYVHVKEDHPSKKEKAEDESNDFRAIAADASVFT
FGDEDDYASE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcgccggaagctcccgtgagcgtatcggtggagccgtcggaggtgcctgtc
gagatttcggttacggagggagctgctgcggcgactcagcagcggtcgaaattctaccag
aggagcgccagtttcttctcgagaacagccgccgctactccaggtgacggatctacagag
gcgccgtccaagctctcagtggctgggatctcgacgtgggccaagagcttgaagcttcca
atctctccgaaagatgccaaagagaattcaaatgcgagctcgcccaaggactccaagtcg
cctttcagcattctctccagtggatttgggaagagagtcccggccaagatcccagtggtg
gacgacgaattgcccaccacaacagccccggctcaagctcaagacggggcatttggtact
ttcacgaagggatttctcgactcgtccaggaatgcagtcaaggtggtccaaacaagagct
aggcatttggtctcgcagaacaaacgacgctatcaggaaggtggcttcgacttggacatg
acgtatatcactgatagcattatcgccatgggctttcctgccggcgacatgagctctggt
atccttggctacgttgagggattttacagaaaccatatggaggaagttataaggtttttc
gaaacgcaacataaggggaagtacaaagtgtataacctttgctctgaaaggctttacgat
gtttctttgctggaaggcaaggttgcatcgtttccattcgacgatcacaattgtccccca
ctgcaattggtcttggccttctgtcgaagtgcatatggttggcttaaagagaacctcgac
aacgtcgtagtggttcattgcaaagcggggaaagcgcgcaccgggttgatgatatcgtgc
cttcttctgtatcttaagttttttccgactgccgaagaatgcatcgcaaactataacgag
aggcggtgcatcgatagcaagggtcttattctaccgagtcaaattcgttatgtcaagtat
tttgaacgcgttctaaaggaattcaacggagaaacaccagccgggcgaaagtgcattctt
agggggatcaggcttcataggtgcccttattggatcagaccagccatcacagtatccgat
cacaatggcatattgttctcaacaaaaaaacatccgaggacgaaagacatgatgcctgaa
gatttctggttcagtgcacccaggagagggataatggtgttcgctttgcccggagagagg
tgcgtcgcggatcttgatggcgatttcaagatcctttttcaggaccgccacggagacttt
tactgctggctaaacacaaccatgatggagacaagacaaattctcaacgtggcagatctc
gatgggttcgacaagaggaggcttccttctccaggctttcaagtagaagtggtaattctg
gatccaaacgcgagtgtccctcctgtacctcctcgcgaaagcccaccgctgccacaggct
ccccagcgatcacccgacacagaatcccgcgagaacgacgacgtattcagtgatagtgaa
gatggcgattctcacagaaaggagaaccaggcagcagcagcagcagtagtgagcagcgag
aatcgtccaaagtcatccgattcgtctccggcggcggaagaagctcccaaagctcgatca
gacaaggacgaatccagtgactacgtccatgtcaaggaagatcatcccagcaagaaggag
aaggctgaggatgaatcgaatgacttccgagcgatcgcggcggacgcctccgtgtttacg
tttggagacgaagacgactacgccagcgagtag

DBGET integrated database retrieval system