KEGG   Selaginella moellendorffii: SELMODRAFT_183219Help
Entry
SELMODRAFT_183219 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smo01009]
    SELMODRAFT_183219
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SELMODRAFT_183219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-GeneID: 9629816
NCBI-ProteinID: XP_002987569
JGI: 183219
UniProt: D8SVZ9
LinkDB All DBs
Position
Unknown
AA seq 317 aa AA seqDB search
MACGEEDAVLDLTSSQLHDLSDVNLPPGLVELDLTANRLSFLDQRMQHLSRLKKLSLRQN
LLADDAVQALGEWPSLFGLQELVLRDNKLTRLPPVGGLSELVVFDVSFNELTSLDGMNKV
CSKLRELYLSKNEIVKMEQLEHMQELRLLELGSNRIRVLEGIENMKRLEELWLGRNRIRT
VNLCGLTSIVKLSLQSNRLTSMLGFEECLALEELYLSHNGISKMEGLATLVNLRVLDVSS
NRLTSIADVENLEKLEDLWLNDNNIPSLDGIETILSGPRQSLSTIYLERNPCASDSSYVN
KLIAALPKLGQIDSRVL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtggcgaggaggacgctgtgctggatctcaccagctcgcagctgcacgatctt
tcagatgtcaatctcccgcccggccttgtggagctggatttgacggcgaatcgtctctcc
ttcctcgatcagcgaatgcaacacctctcgcgcctgaagaagctcagcttgcgccaaaat
cttctcgcggacgatgctgtgcaggcgctcggcgagtggccctcactgtttggactccaa
gagctagttttgcgagacaacaagctcactagacttccaccagttggagggctgtcggag
ctagtcgtgtttgacgtctcgttcaacgagctcacatcgctggatggcatgaacaaagtt
tgctcgaagctgcgagagctttatctgtccaagaacgagatcgtcaagatggagcagctt
gaacatatgcaggagctccgcttgctcgagctaggctccaataggatccgggtgctggaa
ggaattgagaatatgaagcgactggaggagctctggctaggccgaaatcgcatcaggacc
gtcaacctttgtggcttgacatcgattgtcaagcttagcttgcaaagcaaccggctgaca
tcaatgctcggtttcgaggaatgcttggcgttggaagaactatacttgagccacaatggc
atatccaaaatggagggacttgccacactcgtcaatcttcgagtgctggatgtctcttcg
aacaggctgacgtctatcgcggacgtcgagaaccttgaaaagctcgaggacttgtggttg
aatgacaacaacattccttctctcgatggcatcgaaacaatcctctctggtccacgacaa
tcgttatccacaatctatctggagcgcaatccatgcgcgtctgattcctcgtacgtgaac
aagcttattgcagctcttcccaagcttgggcagatcgattcgcgcgttctttag

DBGET integrated database retrieval system