KEGG   Selaginella moellendorffii: SELMODRAFT_185263Help
Entry
SELMODRAFT_185263 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smo  Selaginella moellendorffii
Pathway
smo00564  Glycerophospholipid metabolism
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_185263
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SELMODRAFT_185263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox Pyr_redox_2 GIDA NAD_binding_8 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 9631242
NCBI-ProteinID: XP_002990423
JGI: 185263
UniProt: D8T467
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MLRHSAALGALIGGIAIVSYAKSQPVLAKERGNGAVDSLRDRMAAVNWTVPPRLVQEALL
RGTSPASPLDLLVVGGGATGCGVALDAAARGLRVGLVERDDFASGTSSRSTKLIHGGVRY
LEKAVFQLDYKQLNLVFHALDERAQLIQNAPHLCHSLPTMTPCYQWWEIPYYWAGLKLYD
IVAGRQMLHLSRYHSAKESFEFFPTLAKTAGDGKTLKGTVVYYDGQMDDARVNVSLACTA
ALAGAAVLNHAEATAIIKDESTGQVVGARVRDNLSGRDFDVHAKVVVNAGGPFVDELRRF
ADKESKPMIAPSSGVHVVLPDYYSPESMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSISP
ITMLPEPKEEEIQFILDAISDYVCVKVRRSDVMSAWSGIRPLASDPSANGDTSSISRDHV
ICVEPHGMVTITGGKWTTYRSMAQDAVDAAIKSGNLSPTNGCVTRDLPLIGGEGYDPSCF
AIIAQQYVRMKRTYGGKIIPGAMDTAAAKHLASAYGGMAHRVALIAQNEGLGKRLAHGYP
YLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAANQALPRVIEILAEEHKWDKHRKKL
EISKAKAFLETFKSSKNAQFFDGKHKMVR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggcacagcgcggcgttgggagctctgatcgggggcattgcaatcgtgtcctac
gccaaatcgcagccagtgctggccaaggagcgggggaatggcgcagtggattcgctcagg
gacaggatggcagctgtgaattggacagtgccgccgcgattggtccaggaggcgctcctg
cgcggcaccagcccggcaagccctcttgatctcctggtagtcgggggtggcgccaccggc
tgtggagtcgcattggacgccgctgctcgtggcctccgtgttgggctggtcgagagggac
gatttcgcgtctgggacttcttccaggtctaccaagctcatccatggaggtgtgagatat
ctcgagaaggcagtgtttcagctggactacaagcagctcaacctcgtcttccacgcactg
gacgagcgagcgcagctcatccagaatgctccacacctctgccactcgctccccaccatg
actccctgctaccagtggtgggagatcccatactactgggccggactaaagctctacgac
atcgtcgctggccgccagatgcttcacctctccaggtaccactccgccaaagagtccttc
gagttcttcccgacgcttgcaaagacagccggcgatggaaagacgctcaaaggcacggtg
gtctactacgatggccaaatggacgatgctcgcgtcaacgtttctctggcttgcacggcg
gcgctggcgggagcagcggtgctcaaccacgcagaggcaaccgcgatcatcaaggatgaa
tccactggccaagtcgtgggtgctcgagtccgggacaatcttagcggcagggactttgac
gtgcatgcaaaggtcgtggtgaatgccgggggaccttttgtggacgagctgagaagattt
gcggacaaggagtccaagccgatgatcgctcccagcagtggcgttcacgtcgttcttccc
gactactactcgcccgagtctatggggctcattgttcccaagacgaaagatggccgggtg
gtgtttatgctgccatggctgggaagaacggtggctggcaccactgattctatttcccct
atcaccatgcttccggagccgaaggaagaggagatccagttcatcttggacgccatcagt
gactacgtctgtgtcaaggtccgtcgctctgatgttatgtccgcgtggagcggcattagg
cctctagccagtgatccgtccgcgaatggagacacgtcaagcatctccagagatcacgta
atctgcgtggagcctcacggcatggtgacaatcaccggtggaaagtggacgacttacaga
agcatggctcaagatgccgtggacgccgcaatcaaaagtgggaacctctccccaacaaat
ggctgtgtgacgagagacttgcctttaatcggtggcgaaggctatgatccatcgtgcttc
gcaattattgcacagcagtacgttcgcatgaagcgcacttatggtggaaaaataatcccg
ggagccatggacactgcggcggcgaagcacctggcttcggcctatggaggaatggctcat
cgtgttgcgctcattgcccagaacgaaggtcttggaaaacggctggcgcacggctatcct
tacctagaggccgaggtcgcgtattgcgcgagaaacgagtattgcgagtccgcagtggac
tttatcgcgaggagatcgaggctggcttttctggacacggatgcagcgaaccaggcactc
cctcgggtgatcgagatactggcggaggagcacaagtgggacaagcacaggaagaagctg
gagattagcaaagccaaggcgttccttgagactttcaagtcgtccaagaacgcgcagttt
tttgatgggaaacacaagatggtgaggtaa

DBGET integrated database retrieval system