KEGG   Selaginella moellendorffii: SELMODRAFT_227145Help
Entry
SELMODRAFT_227145 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00020  Citrate cycle (TCA cycle)
smo00620  Pyruvate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Module
smo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_227145
   00020 Citrate cycle (TCA cycle)
    SELMODRAFT_227145
   00620 Pyruvate metabolism
    SELMODRAFT_227145
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SELMODRAFT_227145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 9633559
NCBI-ProteinID: XP_002960157
JGI: 227145
UniProt: D8QPY3
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MAAIAGAASVAAPSFEEISRKSRFLGDGVPSAAAAAPSARPSRRSRRSLRVQAKIREIFM
PALSSTMTEGKIVSWMKAEGDKLSKGESVVVVESDKADMDVETFYDGYLASIVVGEGEVA
PVGAAIGILAESLDEVAEAKAKFAASSGSAPPPAPPPAAIDSIAPAAPVSSPPPPPPPPS
AAPAPAVAAATPVVSSHPASQGGTRIVATPYAKKLAKELKVDLAAVAGTGPSGRITGADV
EASTGKAPVTAAAVTAAPVTAAPSPVSSAPAAAPAPVPLGSTVPFTGMQAAVSKNMVESL
SVPTFRVGYTITTDALDALYKKIKSKGVTMSALLAKAVALAVAQHPVMNASCKDGKSFTY
NASINIAVAVAIDGGLITPVLQDADKLDIYSLSRKWKELVDKARAKQLQPSEYNSGTFTL
SNLGMFGVDRFDAILPPGTGAIMAVGASAPTVVATSDGLFGIKNQMQVNITADHRIIYGA
DVAAFLQTLAKIIENPKDLTL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaattgcgggagcagcgtccgtggcagcgccttctttcgaagagatttcgcga
aaatctcgattcctgggagatggcgtcccatccgcggcagcagcggcgccgtcggccagg
ccgtcgaggagatctcgcaggagcttgcgcgtccaggccaaaatccgggagatcttcatg
ccggcgctcagctccaccatgaccgaggggaagattgtgtcgtggatgaaggccgagggc
gacaagctgagcaaaggcgagagcgttgtggtggtggaatcggacaaggccgacatggac
gtggagacgttctacgatggctacttggcctccatcgttgtgggagagggagaagtggct
cccgtgggcgctgcgattggaattctcgccgagagcttggacgaagttgccgaagcaaag
gcgaagtttgcagcgtcgtctggaagtgctcctcctcctgctccgcctccagcagcgatt
gattccattgctcccgctgctccagtctcgtcgccaccaccgccgccgccgccaccctcg
gcagctccagctcctgctgtggctgctgccactcctgtggtttcatctcatcctgcgtcg
caaggaggaacgaggatagtggctacgccatacgcgaagaagcttgccaaggaactcaag
gtggatctggctgctgtcgctggaactggtccctcgggcaggatcactggagctgatgtc
gaagcatccactggaaaagctcctgttacagcagctgctgtcactgccgctccggtgacc
gccgctccttctccagtttcgtcggctccagcggctgctccagccccagttccgctggga
tcgaccgttcctttcactggcatgcaagcggcagtctccaagaatatggtggagagcctc
tcagttccaactttcagagtgggatacacgatcaccaccgacgctctcgacgcgctctac
aagaagatcaaatccaagggagtgaccatgtccgctctcttggccaaggccgtggctttg
gcggtagcacagcaccccgtgatgaacgctagctgcaaggatgggaagagcttcacgtac
aacgccagcatcaacatcgccgttgcagtagcgattgacggcggacttatcacccccgtt
ctgcaagacgccgacaagctggatatctacagtctatcacggaagtggaaagagctcgtt
gacaaggctcgcgcgaaacaactccagcccagcgagtacaactcaggaactttcactttg
tcaaacctggggatgtttggcgttgataggtttgacgcgattctcccacccggcacggga
gcgattatggctgtgggagcttctgctccaactgttgtggcaacttcagatggtctcttt
ggaatcaagaaccaaatgcaggtgaacatcactgcggatcacaggatcatctatggcgcg
gacgtagcagcatttttgcagacactagcgaagatcatcgagaaccccaaggatctgact
ctataa

DBGET integrated database retrieval system