KEGG   Selaginella moellendorffii: SELMODRAFT_233596Help
Entry
SELMODRAFT_233596 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SELMODRAFT_233596
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SELMODRAFT_233596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 9656962
NCBI-ProteinID: XP_002980788
JGI: 233596
UniProt: D8SBS8
LinkDB All DBs
Position
Unknown
AA seq 151 aa AA seqDB search
MKAVAVLLGSEVGGVVHFSQENEGAPSTITGEVTGLSPGKHGFHVHALGDTTNGCNSTGP
HFNPTNKEHGAPEDDTRHVGDLGNLTAGDSGKVEISIKDSQIKLCGPHSIIGRAIVVHAD
PDDLGKGGHELSKETGNAGARVACGIIGLEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggcggtcctgttgggtagcgaggtgggcggggtggtgcatttcagccag
gagaacgaaggtgcgccgtccactatcacgggcgaggtcaccggtttgagcccgggcaag
catggattccacgtccacgcgctgggtgataccaccaacgggtgcaactccacgggtcca
catttcaatcccaccaacaaggaacacggtgctcccgaggacgacaccaggcatgttggt
gaccttggcaacctcactgcaggcgacagcggaaaggtggagatttctatcaaagacagc
cagataaagctgtgcgggccgcattccatcattggcagggcaattgtggtgcatgccgac
ccggatgatctcggcaaaggtggtcacgagctgagcaaggaaactggtaatgcgggtgca
agagttgcttgtgggataattgggctagaagcttag

DBGET integrated database retrieval system