KEGG   Selaginella moellendorffii: SELMODRAFT_236158Help
Entry
SELMODRAFT_236158 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smo  Selaginella moellendorffii
Pathway
smo00630  Glyoxylate and dicarboxylate metabolism
smo00710  Carbon fixation in photosynthetic organisms
smo01100  Metabolic pathways
smo01200  Carbon metabolism
Module
smo_M00165  Reductive pentose phosphate cycle (Calvin cycle)
smo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
smo_M00532  Photorespiration
smo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SELMODRAFT_236158
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_236158
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SELMODRAFT_236158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 9659974
NCBI-ProteinID: XP_002990955
JGI: 236158
UniProt: D8T5P3
LinkDB All DBs
Position
Unknown
AA seq 160 aa AA seqDB search
METAAAPLNARKPSTSFPKIDGSEPPVSSGSRVNCMQIVCPLSNSRFETLSYLPPLSPDN
VAREIDYMLSKNWIPCLEFDHVGAISRENSREPGYYDGRYWTLWKLPMFGCSDPAQVLRE
IEECKSMYPNAYIRVLGFDNIKQVQCISFIVQKPSKKQSE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgctgctgcccctttaaatgcccggaaaccctcaacgagcttccctaagatc
gacggcagcgaaccaccggtttcgagtggcagccgcgtgaattgcatgcagattgtttgc
ccgctctccaattcccggttcgaaacgctctcgtatttgccccctttgtcacccgacaac
gttgccagagagatcgactacatgctgagcaagaactggattccctgcctcgaattcgat
cacgttggggcgattagccgtgagaactcgcgagaacctggttactacgacggtcgctac
tggactctttggaagctcccaatgtttggctgcagtgatccagctcaagttttaagggaa
atcgaggagtgcaaatccatgtatcccaatgcctacattagggttcttggatttgacaac
atcaagcaagtccagtgcatcagcttcatcgtccaaaagccatcgaagaagcagtccgag
taa

DBGET integrated database retrieval system