KEGG   Selaginella moellendorffii: SELMODRAFT_269350Help
Entry
SELMODRAFT_269350 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00051  Fructose and mannose metabolism
smo00052  Galactose metabolism
smo00500  Starch and sucrose metabolism
smo00520  Amino sugar and nucleotide sugar metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Module
smo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_269350
   00051 Fructose and mannose metabolism
    SELMODRAFT_269350
   00052 Galactose metabolism
    SELMODRAFT_269350
   00500 Starch and sucrose metabolism
    SELMODRAFT_269350
   00520 Amino sugar and nucleotide sugar metabolism
    SELMODRAFT_269350
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SELMODRAFT_269350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_269350
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SELMODRAFT_269350
Membrane trafficking [BR:smo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SELMODRAFT_269350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9657493
NCBI-ProteinID: XP_002988103
JGI: 269350
UniProt: D8SXJ2
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MGKAAVTITIACAAATCAAVAAAFFVNRRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQI
VDNMVVEMHAGLAIDGGSKLKMVLSYVDNLPTGNEEGLFYALDLGGTNFRVLRVQLGGKE
KRIMNQEYKEVSIPPKVMVGSNEDLFDFIATELASFVASEGEGFYLLPGQQRELGFTFSF
PVKQTSINSGTLMKWTKGFAIAETVGKDVVEELQGAMHRSNVDMRVAALVNDTVGTLAGG
RYEDDDVMVAVILGTGSNACYVERADAIPKWRGPLPASGSMVINMEWGSFTSAHLPKTEV
DDALDADSVNPCDQIFEKMISGMYLGDIVRRVLWKLAAEAAFFGGKVPSRLEVPFILRTP
DVSAIHADQSPDLKEVIRVLRVVFGIQSSTLQMRKMIVDVCDIVAERGARLAGAGIVGIL
KKIGRDGGSLANNGGLENHSYAAAEERKKTVVAMDGGLYEHYPKFREYLKQSVVELIGKE
AAEHIELRLSKDGSGIGATLLAASHSSFVAEQE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagctgcggtgacgatcacaattgcctgcgcggctgcgacatgcgcggccgtg
gcggcggcattcttcgtcaacaggcgcttgcggcagcggacgagctggaagagggcgcaa
tgcatcgtcgacgagttccgcggcggctgctccaccccgctctcgcggctgcggcagatt
gtcgataacatggtcgtggagatgcatgccgggcttgcgatcgatggcggcagcaagctc
aaaatggttctaagctatgtggacaatctcccgactgggaacgaggaaggcctgttctac
gcgctcgacttgggagggacgaacttccgggtgctcagagtacaattgggtggcaaggag
aagagaatcatgaaccaggagtacaaggaagtgtccatacctcccaaagttatggttggc
tcgaacgaggatttatttgattttattgccacagagctagcaagcttcgttgccagcgaa
ggggagggcttttatctgctcccaggacagcagcgggagctgggatttacgttctcgttt
ccggtgaagcaaacgtcaatcaactccgggacgctcatgaagtggacgaaaggtttcgcc
atcgcagagacggttggcaaagacgttgtcgaggaattgcagggggcaatgcatcgtagc
aacgtagacatgcgagttgcggctctggtgaacgatactgtgggaacgttggccggggga
agatacgaggacgatgacgttatggtagcggtaatactgggcaccggaagtaatgcctgt
tacgtggagcgagcggacgcgataccaaagtggcgaggcccgttaccagcctctggatcc
atggtcatcaatatggagtggggaagtttcacgtcggcccaccttccaaagactgaggtt
gatgacgccttggatgccgacagcgttaacccatgcgatcagatattcgagaaaatgata
tctggaatgtacctgggtgacattgtgaggagagtgttgtggaaactggctgccgaagcg
gcattctttggaggaaaggtaccttcaaggctcgaagtcccttttattttgaggactccg
gatgtgtctgcaatccacgccgatcaatccccggacctcaaggaagtaatccgggttttg
agagtggttttcgggatccaaagctcgacgttgcagatgcggaagatgattgtggatgtg
tgtgacatcgtcgcagagcgtggcgcccggctggcaggcgctgggattgtcggtatccta
aagaagatagggagggacggtggatccttggcaaacaatggcgggttggagaaccactcg
tacgcggcggcggaggaaaggaagaagacggtggtggcgatggatggtggtttgtacgag
cactatcccaagttccgagagtatctcaagcagtcagtggtggagctgattggcaaggag
gcggcagagcacatagagttgaggctatccaaggatgggtctgggattggagctacgttg
ttggctgcgtcccattcttcgttcgtcgcggaacaggagtag

DBGET integrated database retrieval system