KEGG   Selaginella moellendorffii: SELMODRAFT_414166Help
Entry
SELMODRAFT_414166 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SELMODRAFT_414166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smo03400]
    SELMODRAFT_414166
Enzymes [BR:smo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SELMODRAFT_414166
DNA repair and recombination proteins [BR:smo03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     SELMODRAFT_414166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT_2 PTCB-BRCT BRCT RNA_ligase mRNA_cap_enzyme DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 9656363
NCBI-ProteinID: XP_002973996
JGI: 414166
UniProt: D8RRV7
LinkDB All DBs
Position
Unknown
AA seq 1171 aa AA seqDB search
MGENTVRFSAVSDMLERISKSKKLPVKRKTFRTFLDHFYTDREYFSVMRLVLPELDRERG
NYGLKESVLAKCLADALGLAKGSSDADKLVNWRKGGSSVGKNAGNFALVAAEIVGSRQSH
TSGGLTVKRVNELLDQLAEVKSREEKSKVLAEFINKTNPVEMKWLVMIILKDLKLGISEK
TVFKEFHPDADEVYNKTCDLKLVCEKLVDPKVRFKRQDIEVGKAVRPQLASRVKNAEDAW
KRMRGKRVIAECKFDGDRCQVHKDGNEVHFFSRSSIDHVEFAAAMSSVICENVKASKCIL
DGEMVVWNRVTNKFAEFGTIHAVAKNAKDGVQSDEQLCYIVFDILYLDDCSVIHQPLCER
QKLLEQKVTTVPGRFELLQPDRRNCGGQLWSITPQSAADVEKFFLMTVDNREEGIVVKDF
DSKWEPGDRSGKWMKLKPDYVKESEMDVLIIGGYYGSGRRGGDVAQFLLGIAERPASGYP
TKFHSFCKVGTGLSDEECRVLVDKLRPYFRKYDKNTKPPSYYVVTNNAKERPDVWIEQPD
KSVLLEVKSDIRKIKSEVFASPYSLRFPRVTRVRYDKPWNECLDIQELVRMVAEDTGAGV
NGDGDGGRKKKQERSPKKKAPKLPLLAPHMQQTDVSGVKKVSDMLSGLVFFLVNFKLEDK
ERFHKLVAEYGGKFSMNLNGDVTHVLAESPKGLLYETATKRGDVIHSSWFMDSIAAKELL
PLRPKYMLHLSYKTRETLKDTLDEFGDHYFVEVDEADMKQLFGRMRVEELSVNDKDVDEH
RGSLGDRKNIFEGCSFYFYYPREAAVADEAMIAGVVLRRLEVEVELRKGAVKPSLARATH
MIVFWDSERDHSEAGLSFSENKLVSSKKLRVLSHRWLEEALRRDSVPPEDDYDVRQALGS
RLVEESPPRQEEPELSKENSEHEAGDEEQDEERVSVFDTLVLEEMDGLENEELPPKKKRH
LQEMATPTLAKTLTLPTTSSSLDLWPTAQEAGANPTLVTSETLKLPSFEPQKLAACSETL
KLPSLEPRKLAACSETLKLPETPPATVITETVKLPSFEPDKAFDNLLADFAFLPSITREA
PAKGFAAPQQNKPRIVQEEVAKEDTAMKKSKASYKIEVPVEGFAGGFAAPQRNEPGTFQE
NGSSSREEIAMPMPAKKKNKTSLKDVVRNLL
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaacacggtgagattcagcgccgtcagcgacatgctggagcgcatttccaag
agcaagaagctgccggtgaagcgcaagaccttccgcacctttctggatcacttctacacc
gatcgcgagtatttcagcgtgatgcgcctagttcttccggagctggacagggagcgcggc
aactacggcctcaaggaatcggtgctggccaagtgcctcgccgacgcgctgggcctggcc
aagggatccagcgacgccgacaagctcgtcaactggcgcaagggtgggtcgagcgtcggg
aagaatgccggtaactttgcgctggtcgccgccgagatcgtgggcagccgccagagccac
acctcgggcggcctcaccgtcaagcgcgtgaacgagctcctggatcagctggccgaggtg
aagagccgcgaggagaaatccaaggtcctggcggagttcatcaacaagaccaatcccgtg
gagatgaagtggctggtgatgatcatcctcaaggatctcaagctgggcatcagcgagaag
accgtcttcaaggagttccaccccgacgccgacgaggtgtacaacaagacgtgcgatctc
aagctggtttgcgagaagctggtggatcccaaggtgcgattcaagcgccaggacatcgag
gttggcaaggcggtgaggccgcagctcgcgtcccgggtgaagaacgccgaggatgcgtgg
aagaggatgagggggaagagggtgatcgccgagtgtaagttcgatggtgatcgctgccag
gtccataaggatgggaacgaggtccactttttctccaggagctccatcgatcacgtcgag
tttgccgcggccatgagcagcgttatctgcgagaacgtcaaggcgtcgaagtgtatcctc
gacggggagatggtggtgtggaaccgagtgacgaacaagtttgcggagtttgggacaatt
catgcggtggccaagaatgccaaggatggcgtccagagcgacgagcagctttgctacatc
gtcttcgacattctctacctggacgattgcagcgtgattcaccagccgctctgcgagcga
cagaagctgctcgagcagaaggtgacgactgtccctggccggttcgagctgcttcagccg
gatcggaggaactgcggcggccagctctggtcgatcactccacagtccgctgccgacgtc
gagaagttcttcctgatgaccgtggataacagggaggagggaatcgtcgtcaaggacttt
gattccaagtgggagcctggggacaggagtggaaagtggatgaagctcaagcccgactac
gtgaaggagagcgagatggatgtgctgatcattggtggctactatggatcgggacggcgg
ggtggtgatgtggctcagtttcttctcggcattgccgagcgtccagcgagcgggtatccg
accaagttccactcgttttgcaaggttggcacggggctcagcgatgaagagtgccgagtt
ttggttgacaaactaaggccgtatttcagaaaatatgacaagaacaccaagcctccgagt
tactacgtggtgactaacaacgccaaggagcgcccggacgtgtggatcgagcagccggac
aagtctgtgctcctggaggtgaagagcgatatccgaaagatcaagtcggaggtgtttgcc
tcgccttacagcctccgctttccaagagttaccagggtccggtacgacaagccttggaac
gagtgcttggatatccaggagcttgtgaggatggtggcggaggacacaggtgctggtgta
aatggagatggtgatggcggccggaagaagaaacaggagaggtctcccaagaagaaagct
ccaaagcttcctttgctggcgcctcatatgcagcaaacagacgtttccggcgtgaagaag
gtgtccgacatgctcagcggcctggtcttcttcctggtgaatttcaagctcgaggacaag
gagaggttccacaagctggtggccgagtatggagggaagttctcgatgaacttgaatggc
gacgtaactcacgtccttgccgagagtccgaagggccttctgtacgagaccgcaaccaag
cgaggggacgtgatccattcctcgtggtttatggactcgattgctgcgaaggagctcctt
ccgctcaggcccaagtacatgcttcacctctcgtacaaaacgagggagactctcaaggac
actttggacgagtttggagatcactactttgtggaagtggacgaggcagacatgaagcag
ctgtttggacgcatgcgagtcgaggagctctcagtgaacgataaagacgtggacgagcac
aggggcagccttggcgacaggaagaacatctttgaaggctgctcgttctacttttactat
cctcgcgaggcggcagtagcagatgaagcgatgattgctggagtcgttctcaggaggctg
gaagtggaagtggaattgcgcaagggtgctgtgaagccgtctcttgctagagcgactcat
atgatcgtgttctgggacagcgaaagggatcacagtgaagccggtctctctttctcggag
aacaagctggtttcaagcaagaagctgagagtcttgagtcacagatggttggaggaggcg
ctgaggagggatagtgttcctccggaggacgattacgacgtgaggcaggctttgggatct
cggctggtggaagagtctcctccacgacaagaagaaccagagctttcgaaagaaaactcg
gagcatgaagccggagatgaagagcaggatgaggagagggtgagtgtttttgatactcta
gttttggaagagatggacgggctggagaacgaagaactcccaccgaagaagaagcggcac
ttgcaagagatggctaccccgactctggcgaagacgctcactttgccaactacatcatcg
agtttggacttgtggcctaccgcgcaagaagctggagcaaatccgacactggtgacctcg
gagactttgaagcttccaagttttgagccacagaagttggcagcttgctcggagactttg
aagcttccaagtcttgagccacggaagttagcagcttgctcggagacattgaaacttccc
gaaactcctccagcgacagtgatcaccgagactgtgaagcttccgagctttgagccggac
aaggcgtttgacaacttgctggcggattttgcgttccttccctcgatcacaagagaagct
cctgcgaaaggatttgcagctccacagcaaaacaagccacggatagttcaagaggaagta
gcgaaggaagacacagcgatgaagaagagcaaagcaagctacaaaatagaagttcctgtg
gaaggatttgctggaggatttgctgctccacagcgaaacgagccagggacgtttcaagag
aatggcagctcctctcgggaagaaatagcgatgcccatgcccgccaagaagaagaacaaa
acaagcctcaaggatgtggttcgcaacttactgtaa

DBGET integrated database retrieval system