KEGG   Selaginella moellendorffii: SELMODRAFT_414990
Entry
SELMODRAFT_414990 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
smo  Selaginella moellendorffii
Pathway
smo00071  Fatty acid degradation
smo00073  Cutin, suberine and wax biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_414990
   00073 Cutin, suberine and wax biosynthesis
    SELMODRAFT_414990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:smo00199]
    SELMODRAFT_414990
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     SELMODRAFT_414990
Cytochrome P450 [BR:smo00199]
 Cytochrome P450, plant type
  CYP704 family
   SELMODRAFT_414990
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9636873
NCBI-ProteinID: XP_002974847
JGI: 414990
UniProt: D8RU88
LinkDB
Position
Unknown
AA seq 496 aa
MEMLQLEILLGLLLLVLALLSIHRFSRGGGRDGGLPLIGHTVEVLANYHRIFDLLLEKFQ
SQGTSTVPLWIPGQSYVFTVDPANVEYILKTRFQNFPKGERFREKFQPLLGAGIFNADGA
AWKSQRKTASFEFASRVLREWSGSVFRDHALELARIDLFLRMTLDTICNLGFGVHLGLLS
STLPHNDFAAAFDRCNAIVSFRFADPFWKLKRLLRIGEEGDLPKNLATVDEFTYNIIRKR
RIQLSKENEDLRARKKDLLSRFMLLDESSSDAYLRDIVLNFVIAGRDTTAATLSYFIYMV
ASHPDCQARLHSELLDFDHSSRQHEHHDDDPSSMESFAKLLTLEALAKLPYLHAAVNETL
RLYPSVPLNFKGVASDDVLPDGTRVRRGEIVSYVPYCMGRMESLWGPDAADFRPERWRAV
DGSDWDFNSSPFKFTAFQAGPRVCLGKDSAYLQIKITAALLCRFFEFRLVPNQNLHYRVM
ATISLASGIKVVPLRR
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaaatgttgcagctggaaatcctactgggattgctgctgctggtgctagcgctgctc
tcaatccaccgcttctcgcgaggtggaggacgcgatggaggattgccactgattggccac
acggtggaagttctagccaattaccaccggatcttcgacttgctcctggagaaattccag
agccagggcacgagcaccgtgccactgtggattcctggccagtcctacgtcttcacggtg
gatccagccaatgtagagtacattctcaagacaagattccagaacttcccaaagggcgag
cgcttccgggagaaattccagcctctgctgggcgccgggatcttcaacgccgatggcgcg
gcgtggaagagccagcgcaagacggccagcttcgagttcgcgtccagggttttgcgggag
tggagcggcagcgtgttccgggatcacgcgctggagctcgcccggattgatctcttcctg
cgaatgacgctcgacacgatttgtaacctgggatttggcgtacacctcggcctcctctcc
tcgacgctcccgcacaacgatttcgcggccgctttcgaccgatgcaacgccatagtctcc
tttcgctttgcggatcctttctggaagctcaagaggctgctgcgaatcggcgaggagggg
gatctcccgaagaacctggccacggtcgacgaattcacgtacaatatcattcgcaagagg
aggatccagctctccaaagagaacgaggatcttcgcgctcgcaagaaagatcttctttcg
cgattcatgctactggacgagagttcctccgacgcttatctccgcgacattgtcctcaac
ttcgtcatcgctgggagggacaccaccgccgcgacgctctcgtatttcatctacatggtt
gcctctcaccccgattgccaggccaggctccattcggagcttctcgactttgatcactcc
agccggcaacacgaacaccatgacgatgacccaagctccatggaaagttttgcaaagctc
ctcacgctcgaggcgctggccaagctcccctacctccacgccgcagtaaacgagaccctg
cgcctctatccatccgtgccactgaactttaaaggcgtcgccagcgacgacgttcttccg
gatggcacgcgcgtccgaagaggtgagatcgtgtcttacgtgccatactgcatgggccgg
atggaatcactgtgggggcccgatgccgcggacttccgcccggagagatggcgcgccgtc
gatggatccgactgggatttcaactcgtcacctttcaagttcacagcattccaggcaggg
cctcgcgtttgccttggcaaagacagcgcttatctccagataaagatcaccgcggcgctt
ctctgtcgcttctttgagtttcgtctcgttcccaaccagaatctccactaccgcgtgatg
gctacgatttctctggcttctggcattaaagtcgtgccactgagaaggtga

DBGET integrated database retrieval system