KEGG   Selaginella moellendorffii: SELMODRAFT_423745
Entry
SELMODRAFT_423745 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
smo  Selaginella moellendorffii
Pathway
smo00071  Fatty acid degradation
smo00073  Cutin, suberine and wax biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_423745
   00073 Cutin, suberine and wax biosynthesis
    SELMODRAFT_423745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:smo00199]
    SELMODRAFT_423745
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     SELMODRAFT_423745
Cytochrome P450 [BR:smo00199]
 Cytochrome P450, plant type
  CYP704 family
   SELMODRAFT_423745
SSDB
Motif
Pfam: p450 VCPO_N
Other DBs
NCBI-GeneID: 9644638
NCBI-ProteinID: XP_002984583
JGI: 423745
UniProt: D8S5P1
LinkDB
Position
Unknown
AA seq 520 aa
MVIAHGSGSASWMISIALLLAWWVFLHRLRQRHLAGPKTWPLLGCIVEQARNFDKLHDWL
LGYFNKTLTFSVPMATINNTFTANPANVEYILKTNFNNFPKGDKLCGRFEDLMGQGIFTV
DGERWIHQRKVATAEFASSKLRDYSIHTFRDKALRLVKVLDSASRSGKQVDLQDLFMRLT
LDSICTVGFGVGVGCLSPDLPFVPFAAAFDEAMRLIIRRYVDVFWKIKRAASIGSEARLA
QCLKVVDSFLYQVINRRREEMKRLSSEARADLLSRFMVLEGEEAYTDKMLRDVVMNFMVA
GRDTTALTLSWFFSELCKHPEVADKIVAEVSQVLGSKQQKIPKISDRSSSFDYGLEQEIL
DLAELLDYQTLNKMQYLHAALTEALRLYPAVPLDTKQVIEDDTLPDGTKVRAGQFVSYVP
YSMGRLEHIWGPDATEFKPERWLNSSGVYQPQSPYKFTTFQAGPRMCLGKDSAYLQMKMT
TVMLLKLFNFSLVEGQSLDYRMMAVLYIADGVQAKVTRRE
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggtcatcgcccacggctccggatcggcgagctggatgattagcatcgccctgctgctg
gcctggtgggtgtttctccacaggctgagacagcggcatctggccgggcccaagacgtgg
ccgctgctgggctgcatcgtggagcaagcccgcaacttcgacaagctccacgactggcta
ctcggctacttcaacaagacgctcaccttctccgtccccatggccaccatcaacaacacc
ttcaccgcgaacccggccaacgtcgagtacatcctcaagaccaacttcaacaatttcccc
aagggtgacaagctttgcgggaggtttgaggatctcatgggtcaaggcattttcaccgtc
gacggcgagaggtggatccaccagcgcaaggttgccacggccgagtttgcgtcgtccaag
ctgcgcgattacagcatccacactttcagggacaaggcgctgcggctggtcaaggtgctg
gactcggcctcgcgctccgggaagcaagtcgacctccaggatctgttcatgaggctgaca
ctggactcgatatgcacggtcgggtttggagttggcgttgggtgcctgtcgccggatctg
ccgtttgttccattcgcggccgcgttcgacgaggcaatgcggctcatcatccggagatat
gtggacgttttctggaagatcaagagggccgcgagcattggatcggaggcccggctcgcg
cagtgcctcaaagtggtggacagttttctctaccaagttatcaaccggaggcgagaggag
atgaagagactatcctcggaggctcgagcggacttgctatcgcgattcatggtgctggaa
ggcgaagaggcctacaccgacaagatgctgagggacgttgtgatgaacttcatggtggcg
gggcgagacaccaccgcgctgacgctctcgtggttcttctccgagctttgcaagcacccg
gaggtggcggacaaaatcgtcgccgaagtctcccaggttctaggaagcaagcagcagaaa
attcccaagatttccgacaggagcagcagcttcgactatggactggagcaggagatcctg
gatcttgcggagctgctggactaccagacgctcaacaagatgcagtatttgcatgccgct
ctcacggaagctctccggctctatccagcagtccctctcgacaccaagcaagttatcgag
gatgacacgctcccggatggaacgaaagtccgagcaggccagttcgtgagctacgttcca
tacagcatgggaagattggaacacatatggggacccgacgctaccgagttcaagccagag
aggtggctcaactcgagtggtgtctatcaaccgcaatctccatacaaattcacaactttc
caggccgggccacgaatgtgcctgggaaaggactcggcatatcttcaaatgaagatgacc
accgtgatgctgctcaagctgtttaacttcagcctggtagaaggccagagcctcgactat
agaatgatggcagtgctctacattgccgatggcgtccaagccaaagtcacgagaagggag
tga

DBGET integrated database retrieval system