KEGG   Selaginella moellendorffii: SELMODRAFT_444651Help
Entry
SELMODRAFT_444651 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
smo  Selaginella moellendorffii
Pathway
smo00250  Alanine, aspartate and glutamate metabolism
smo00410  beta-Alanine metabolism
smo00430  Taurine and hypotaurine metabolism
smo00650  Butanoate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SELMODRAFT_444651
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_444651
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_444651
   00430 Taurine and hypotaurine metabolism
    SELMODRAFT_444651
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SELMODRAFT_444651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 BHD_1
Motif
Other DBs
NCBI-GeneID: 9656977
NCBI-ProteinID: XP_002980886
JGI: 444651
UniProt: D8SBV2
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MVLTMTSEADSSLQSTFASRYSQSSVSKYRIPDQETPKDAAYQIISDELMLDGNPRLNLA
SFVTTWMEPECDKLVMASLNKNYIDMDEYPVTTELQDRCVNMIARLFNAPVGDSEQAIGA
GTIGSSEAIMLAGLALKRKWQNKRKAEGKPWDKPNIVTGSNVQVCWEKFARYFEVELKEV
KLSKDYYVMDPHKAVEMVDENTICIAAILGSTYNGEFEDVKLLNELLEKKNKETGWDTPI
HVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRGKEDLPEELV
FHINYLGADQPTFTLNFSKGASQIIAQYYQLIRLGFRGYKSIMQNCQANAKILADALVAT
GRFVILSKEIGVPVVAFSLKDRKNHDEYEIADHLRRYGWIVPAYTMAPDAQDVTLLRVVV
REDFSRTLADRLVSDIVAVFKYLDAHPPRLIQAVTEALAKDPEIKKELLDAEPGEVKAQL
DLRKASVFEDIRNSQRAFKVWKKFALSKTNGVC
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggttctcacaatgacctccgaggcggattccagcctccagtccacgtttgcttctcgc
tactcgcaatcgtcggtatcaaagtaccgcattcccgaccaagagacgcccaaggatgcc
gcttatcagattatctcggacgagctcatgctggatggaaatcctcgtctcaatctcgcc
tccttcgtcaccacttggatggagcccgagtgtgataagctcgtcatggcctcgctcaac
aagaattacatcgatatggacgagtatccggtgaccacagagctccaggatcgatgcgtg
aacatgatcgctcggctgttcaatgctccagtgggagactcggagcaagcaattggagct
ggaactattggttcttccgaggcgataatgctggctggcttagctctcaagcgaaagtgg
caaaacaagaggaaggccgaaggaaagccatgggataagccaaacattgtcactggatca
aacgtccaggtttgctgggagaagttcgctcgctactttgaagtggagctcaaggaagtg
aagctgagcaaggattactacgtgatggatccacacaaggcggtggagatggtggacgag
aacaccatttgcattgcagccatccttggttccacttacaacggagagttcgaagacgtg
aagctcctcaacgagctcttggaaaaaaagaacaaagaaactggatgggatactcctatc
cacgttgatgctgccagtggaggattcatcgctccattcctctatccagatttggagtgg
gattttcgattgcctcttgtcaagagcatcaatgtgagtggccacaagtatggattggtg
tacgctgggattggctgggttatctggagaggcaaggaagatcttccggaagagctcgtc
ttccacatcaattatcttggagccgaccagccaactttcactctcaatttttccaaaggt
gctagtcagattatagctcagtattaccagctcattcgtctcggcttcaggggatacaag
tctatcatgcaaaactgccaagccaatgctaaaatcctggctgatgctctcgttgccact
ggccgcttcgtcattctctccaaggaaattggagttccagtggtagcgttctcgctcaaa
gaccgcaagaaccacgacgagtacgagattgctgaccatctccgccgctacggctggatc
gttcctgcttacaccatggctccggatgcccaggatgttacgctgctccgagtcgttgtc
cgggaggacttcagcaggactctggccgatcgtctcgtctccgacattgttgcggtgttc
aagtacctggacgctcatccccctcggctaatccaggctgtaaccgaagctttagccaag
gatccggagatcaagaaagagctcttagatgccgaaccgggggaggtgaaggcccagctg
gatctacgaaaggcttccgtgtttgaggacattcgcaactcgcagcgagctttcaaggtc
tggaagaagttcgcgctaagcaaaacaaatggtgtctgctga

DBGET integrated database retrieval system