KEGG   Selaginella moellendorffii: SELMODRAFT_446978Help
Entry
SELMODRAFT_446978 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
smo  Selaginella moellendorffii
Pathway
smo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SELMODRAFT_446978
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SELMODRAFT_446978
Chromosome and associated proteins [BR:smo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SELMODRAFT_446978
   Polycomb group proteins
    PRC2-EZH2 complex
     SELMODRAFT_446978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR WIYLD
Motif
Other DBs
NCBI-GeneID: 9628852
NCBI-ProteinID: XP_002987466
JGI: 446978
UniProt: D8SVT1
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MQSMEEGEASGKVSMAALSATFTRLKKQVAFERQAYVKARMDANSERLQGFCTHLLALSS
SRAVNNRNHADNDMLNTRIQKALNKLGTDPAAADQQCGSQDDSSAPILFNNSGGKSIVKP
VRLQTVQKTPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEE
EKRDFSKGDDFLIRATVQEHGLSKMMFKALADCLDAKPSEIEARYEILAKDGDKLKSEEK
HDLLSAMDSFDNLFCRRCLVFDCRLHGCSQPVIIPFDKQTPLNKTGELPSVPCGPCCFHL
PRLSSHHDATSSGVESKPVPVESTAPAIEKSWQVSDSKDKGVATEPVAKTVDKPPEAPKK
SFKDKSVTALRRLLLKRKATRHTDDDTNEARKKHHVEGSHAEVGDGSGNATRGENTGASM
YLKKLVSKKLYAQRKWKGSQITTVKRPPPVIKEPEDVMQSISKNLTLYDSNWNTLEKDLY
ETGLQIFGRDSCLISRNLLRGMKSCAEVGEFMQLEAAVNWKLNEETKLQQDGNTVIEDAT
EIDRSRSRLYNGRRRGRVRRLKYTWKSVGYPAIRKRLVDGKDGCRQYTPCSCSESCGKQC
SCHRNGTCCEKYCGCSKNCKNRFRGCHCAKSQCSSRQCPCFAAGRECDPDVCRNCWIGCG
DGSQGGPPARGDSYECRNMKLLLKQQQRVLLGRSDVAGWGAFLKTPVNKHDYLGEYTGEL
ISHREADKRGKIYDRENSSFLFNLNDQYVLDACRKGDKLKFANHSPNPNCYAKVIMVAGD
HRVGIFAKERISAGEELFYDYRYEADRAPPWARKPEDGQKNDEAASGSGRAQKTA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctatggaggaaggcgaggcatccggcaaggtttccatggccgcattgtcggct
acgttcacccggcttaagaagcaagtggcattcgagcgacaagcttatgtcaaggcaagg
atggatgcaaactcggagagattgcaaggattttgtacgcacttactggcgctgtccagc
tcccgcgctgtgaataacaggaatcacgccgacaacgatatgctcaacacacggatccaa
aaggcgctcaacaagcttgggactgatccagcagccgcggatcagcagtgtggctcgcaa
gatgactcctcggctcctattcttttcaacaattccggtgggaagagcattgtgaagccc
gtcaggctgcaaaccgtgcaaaagacgccgccatatacaacttggatcttcttggacagg
aatcagcggatggccgaagatcaatccgtcgttggtcgaagaaggatctattatgactct
gctgaaaatgaagcgttgatatgcagtgacagtgaggaagaacaagtcgaggaggaagaa
gagaaacgtgactttagcaaaggtgacgattttctcatcagagccactgtccaagaacat
ggattgagtaaaatgatgtttaaggcgctggctgactgtcttgatgcaaagccgagcgag
atagaggcacggtatgaaatactagcgaaggacggggacaaactcaaaagcgaggaaaag
catgatcttctatctgcaatggactccttcgataatcttttctgtcgacgttgtttggtg
ttcgactgtcggcttcatggttgctcgcagccggtgataattcctttcgataagcagact
ccacttaacaagacgggggaactgccgtcagtaccatgcggtccctgctgtttccatttg
ccacgcctttcaagccaccacgatgccacttcttcaggcgtagagtccaaacccgttcct
gtagaaagcacagcacctgctattgagaagagctggcaagtttcggattccaaagacaag
ggcgtcgctacggaaccagtcgccaaaactgtggacaagcctcctgaggctcctaagaag
agcttcaaagataaaagtgtgaccgctctcagaaggttgctactaaagaggaaagcgacg
agacatacagacgatgatacaaatgaggcgcgtaagaaacaccatgtggagggatcgcat
gctgaggtgggagatggcagtggcaatgcgactcgtggcgagaatactggggccagcatg
tacttgaaaaaactggttagcaagaagctttacgctcagagaaaatggaaaggaagccag
atcaccactgtgaagcggccgccacctgtaatcaaggaaccagaggatgtgatgcagagc
atatccaagaaccttacgctatatgacagtaactggaacactttggagaaggacctttac
gaaacagggctgcaaatctttggtagagacagctgtcttatttcaaggaatttgctaagg
ggaatgaagagctgtgccgaggttggggaattcatgcaacttgaggcagccgtgaactgg
aagctgaatgaagaaacaaagctccaacaggatggaaacacagtcattgaggatgcgacg
gagattgaccgttcgcggtccaggttgtacaacggacgcaggaggggacgtgtacgtagg
ctaaagtacacatggaaatccgtgggctatccagctatcaggaaaagactcgtggatggg
aaggatggctgtagacaatacacaccctgctcttgctcggagtcgtgcggaaagcagtgt
tcttgccatcgaaatgggacgtgctgcgagaaatattgcgggtgctccaagaactgcaaa
aaccgcttcaggggctgccattgcgctaaaagccagtgttccagtcggcaatgcccgtgt
tttgcagctggacgggaatgtgatcctgatgtctgtagaaattgctggattgggtgcggg
gatggatcgcaaggcggaccaccggcacggggtgacagctacgaatgtcgaaacatgaaa
cttcttctaaagcaacaacaacgggttttacttggaagatctgatgtcgctggctggggt
gcatttttaaagactccggtaaataagcatgactaccttggagaatacacgggagagctc
atatcacatcgtgaagctgacaagcgtggcaagatttacgaccgcgagaactcgtccttc
ttatttaatttgaatgatcagtacgtactggatgcttgccgcaagggtgacaagcttaaa
tttgcaaatcactcgccaaatccaaactgctatgcaaaggtgataatggttgctggggat
cacagagttggcatatttgcaaaggaacgtatatcagccggtgaggaactgttctacgac
tacaggtacgaagccgatagagctcctccgtgggctagaaaacccgaagacggccagaag
aatgacgaagccgcaagtggatccggtcgggctcagaagacagcctga

DBGET integrated database retrieval system