KEGG   Selaginella moellendorffii: SELMODRAFT_85593Help
Entry
SELMODRAFT_85593  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00020  Citrate cycle (TCA cycle)
smo00190  Oxidative phosphorylation
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SELMODRAFT_85593
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SELMODRAFT_85593
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SELMODRAFT_85593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_7 Fer4_16 Fer4_18
Motif
Other DBs
NCBI-GeneID: 9634336
NCBI-ProteinID: XP_002966401
JGI: 85593
UniProt: D8R553
LinkDB All DBs
Position
Unknown
AA seq 248 aa AA seqDB search
MLSRVLGSKRLTSNGLRSFQVYRYNPQDGKSPHLQEYKVDTSNCVMMLDVLFEIKNKHDS
SITFRRSCREGVCGSCAMNINGKNCLACLTKVDRDEDGIASTVVLPLPHMFVIKDLVVDM
TYFYQQYKSIEPWLKTKKQKEDGQKEFLQTKEERAKLDGMWECILCACCNTSCPSYWWNT
PTFPGPAILLQAYKMIADSRDDFTKERVEALRGEMKIGRCHTIRNCSNACPKGLNPAEKI
LQIKGMLG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacgagttttaggaagcaagcgcttgaccagcaatggtttacggtcctttcaa
gtgtacagatacaatccccaagatggcaaatcaccccacctccaagagtacaaggttgac
accagcaactgcgttatgatgcttgatgttttgtttgagatcaagaacaagcatgattcg
agtatcacgtttaggcgttcttgtcgcgaaggtgtatgtggctcttgcgccatgaacatc
aatggtaagaactgcctggcatgcttaacaaaagttgacagggatgaggatggtattgct
tctactgtggtgttgcctctgccacatatgtttgtgattaaggacctggtggtggacatg
acttatttttatcagcaatacaagagcattgagccatggttgaagaccaaaaagcaaaaa
gaagatggccaaaaagagttcttgcaaaccaaagaggagagagcaaaactggacgggatg
tgggagtgtatcctatgtgcttgttgtaatacttcttgccctagctactggtggaacaca
cctacattccctggtccagcaattctgctccaagcatataaaatgattgctgatagccgc
gatgactttaccaaagagcgtgtggaggccctccgtggagagatgaagattggaagatgc
cacactattcgcaattgctctaatgcttgtccaaagggactgaatcccgctgaaaagatc
ctacagatcaaagggatgcttgggtaa

DBGET integrated database retrieval system