KEGG   Selaginella moellendorffii: SELMODRAFT_91640Help
Entry
SELMODRAFT_91640  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
smo  Selaginella moellendorffii
Pathway
smo00220  Arginine biosynthesis
smo00250  Alanine, aspartate and glutamate metabolism
smo00710  Carbon fixation in photosynthetic organisms
smo01100  Metabolic pathways
smo01200  Carbon metabolism
smo01210  2-Oxocarboxylic acid metabolism
smo01230  Biosynthesis of amino acids
Module
smo_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_91640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_91640
   00220 Arginine biosynthesis
    SELMODRAFT_91640
Enzymes [BR:smo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SELMODRAFT_91640
Amino acid related enzymes [BR:smo01007]
 Aminotransferase (transaminase)
  Class I
   SELMODRAFT_91640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 9646709
NCBI-ProteinID: XP_002969652
JGI: 91640
UniProt: D8REX7
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MTWLSPLTIGNVNPKVKSIVDACSLIEFSLVQVMKCEYAVRGEIVMRAQLLEQELITKPS
SLPFEEIIYCNIGNPQSLGQVPITFFREASVVALCDNPSLLDKAETHALFSADAIARAWK
IIDKIPGKATGAYSHSQGLQYCREEIAAAIARRDGYPAKAEDLYLTDGASVAVHMMMQLL
ISSEKDGIMCPIPQYPLYSASMTLHGGSLVPYYLNESAGWGLEVQELQQQIQKARGSGIN
VRALVVINPGNPTGQVLSEENQKKIIQFCKDERLLLLADEVYQENIYAEGKKFQSFKKVA
RSMGLGENDLSIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISG
QILMSLVSNPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYL
FPRLHLPERALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAE
EKMPALITRLTSFHQRFMDEFRD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacgtggttgtcgccgctcaccatagggaatgtcaatcccaaggtaaaatctatcgtc
gatgcttgtagcttgattgaattctctcttgtccaggtgatgaaatgtgagtatgctgtc
cgaggagagattgtaatgcgagcacagctcctggaacaggaactaatcacgaaaccatcg
tcgctaccattcgaggagattatctactgcaatattgggaatccacagtctctaggccaa
gtaccaatcactttttttcgagaggcaagtgtggttgctttgtgtgacaacccttcgcta
ctcgataaagctgaaactcatgctcttttcagtgctgatgctatagcaagagcctggaag
atcatagataaaattcctggaaaggctactggtgcttatagccacagccagggtctacaa
tattgccgtgaagaaattgcagcagccattgcacgtcgtgatggatatccggccaaagcg
gaggatttataccttacagatggagcgagtgttgcagtgcatatgatgatgcagctactt
ataagctcggaaaaggacgggatcatgtgtcctataccgcaatatcccttgtactcggca
tccatgacactccatggaggaagcttggttccttactatttgaatgagagcgcaggttgg
ggtcttgaagtgcaggaacttcaacagcaaatccagaaagccaggggttctgggatcaat
gttcgagctcttgtagtcatcaatcctgggaatccgactggtcaggtcctgtcggaagaa
aaccagaaaaaaattattcagttttgcaaggacgagcggcttttgttacttgctgatgag
gtgtatcaagagaacatctatgctgaaggtaaaaagttccaatcattcaagaaagttgcg
cgaagtatgggactaggagaaaacgatctcagcatagtatccttccattcggtttcaaaa
ggttattacggtgaatgcggaagaagagggggctacatggaagttacgggagtggacaaa
gacgtcaaggaacaaatctacaagatcgcgtctgtgaatctttgctcaaacatttccggt
caaattctaatgagcctggtttcgaatcctccaaaggccggcgacgaatcttatgaagac
tacgtccgagagcgtgatggcatattggcttcacttgcgagacgcgccaagctgctggcc
gaaggatttaataagctagaaggcgtcagttgcaaccaggccgagggcgcgatgtacttg
tttcctcggctccatttaccggagagagctctcaaggctgcagcagcggtctccatggct
gctgatacgttttacgctcggagattactcgatgcaactggcattgtcgtcgttcctggc
tcaggattcggtcaagttcccggaacttggcacatcagatgcactattcttccggccgag
gaaaagatgccagccttgatcactcgcttgacgagcttccaccaaaggtttatggacgag
tttcgagactga

DBGET integrated database retrieval system