KEGG   Selaginella moellendorffii: SELMODRAFT_92972Help
Entry
SELMODRAFT_92972  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
smo  Selaginella moellendorffii
Pathway
smo00220  Arginine biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01210  2-Oxocarboxylic acid metabolism
smo01230  Biosynthesis of amino acids
Module
smo_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SELMODRAFT_92972
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     SELMODRAFT_92972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 9645326
NCBI-ProteinID: XP_002969699
JGI: 92972
UniProt: D8RF79
LinkDB All DBs
Position
Unknown
AA seq 433 aa AA seqDB search
MTMGEASFLSLLTDFIGKTEKLQNNPPNLIPQESLVVTKVLEVLGPYSIDNGGPLLLKPI
YFQGLQNRKNLIVTYPGEEQDRIVSIVGCHMDVVVADPTKWEHSPFKLTQLEDGDTLYGR
GTTDCLGHVALVTQLLKQMAEAKLRLKTTVAAVFIANEENATVLGIGADALMDAHELDFL
KNGPLYWMDSSDKQPCIGTGGMLAWHLTAHGKLSHSGLPKQGINAIELASEGLKEIQDRF
YNDFPKVVPDEDNYKFDTPSTMKPTQWTYPGSAINQIPDTCTISGDCRITPFYKVDEVEK
KLVQYVDYINQNIEKLETRGPASKYVLPDGTRGKLEITFDAEKMQGIACHMDSKGYKALA
KATEEVLGHVEPFSITGSLPIVGDLQDQGYDVQTIGYGLTSAYHADNEICLLSDMSQGFK
IFAILIADLDNSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactatgggcgaagctagcttcctttcgctgctgacagacttcatcggcaagacggag
aagcttcaaaacaatcctccaaatctgataccacaggaatcgcttgttgtgactaaggtg
cttgaagtgctgggaccttatagcatcgacaatggtggacctttgctcctcaaaccaatc
tattttcaaggccttcaaaataggaagaacctcattgtcacatatcctggtgaagagcaa
gatagaatagtctccattgttggctgtcatatggacgtggtagtggctgatccgaccaaa
tgggaacattcgccgtttaagttaacccagcttgaagatggtgatacgctctatggacga
ggcactacagattgcctcggacatgttgcattagtgacgcagctgttgaagcagatggca
gaagcaaagttgaggctcaaaacaactgtggcagctgtgttcattgcaaacgaagagaat
gccacagtcctgggcattggggctgatgcactgatggatgcacatgaactcgatttcctc
aaaaatggtcctttatattggatggattcctccgacaaacagccttgcattggaaccggt
ggaatgcttgcttggcatctcacagctcatggaaaactttcccacagtggtctaccaaag
cagggaatcaatgcaattgagcttgcttctgagggactgaaagaaattcaggatcgtttc
tataacgattttccaaaggttgttccagatgaagataactacaagttcgacaccccctca
acaatgaagcctacacaatggacataccccgggagtgcaattaatcaaatcccagacact
tgcaccatttctggagattgcaggataacgcctttctacaaggtggacgaagttgaaaag
aaactcgtgcagtacgtggactatataaaccaaaacatagaaaaactggagactcgtgga
ccggcgtctaaatatgtgttaccggatggcaccagaggaaaattggagataacatttgat
gcggaaaagatgcaaggcattgcctgtcacatggactcaaagggatataaagccttagct
aaagccactgaggaggttctgggacatgttgagccgttctcaattactggatcacttcca
atcgttggtgatctgcaggaccaaggatatgacgtgcaaaccataggctatggtttaaca
tcagcatatcatgcagacaacgagatttgcctgctgtcggacatgtcccaaggcttcaaa
atctttgccatattgatagcagacttggataattcattataa

DBGET integrated database retrieval system