KEGG   Selaginella moellendorffii: SELMODRAFT_97261Help
Entry
SELMODRAFT_97261  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 9650996
NCBI-ProteinID: XP_002972609
JGI: 97261
UniProt: D8RNB6
LinkDB All DBs
Position
Unknown
AA seq 620 aa AA seqDB search
WKADELAPYLHLARTFELVEKESGRYRTTEMLCNMFRSLLALSSADVLAALYLTTNRIAP
DYENVDLSIGTATVVMAIEEATGTPKSKLKEMYNRMGDLGDVAQACKQTQSMLRNPQPLL
IRHVFSTLKQISKETGIGSSSRKKNMVVGLLRSCREKEVTYLVRTLVQNMRIGAMVRTVL
PALAEAVVLHRDNSAVAALKHQEVSALIVEAFNLVPNFDILVPFLLEQGMVALATRMVLT
PGIPIKPMLAKIANGVPDVLKIFEGKSFTSEFKYDGFRAQIHLLDDGSVRIFSRNCENST
SRFPDVVEIIKSSTIKRDSRSFIIDAELVAVDRANNNKLMAFQSLSTRERGGRTGTGVDL
DKITVNVCVFVFDVMYVDGEPFVKAPLRLRRRRMHDLFPEVRPGYLDFAAEKTEHNTEHI
QDFLGQAIAASCEGLMVKALDEGSFYAPAKRAESWLKLKRDYVEGLSDSLDLVPIGAWYG
NGRKAGWHSPFLLACYDPDQEVFQSVCRVMSGFTDAFYEQMKEFYSEDKLLSKKPSYYQT
LERPDVWFAAAKVWEIRGADYTISPVHQAAAGLVHPDRGISLRFPRFVGERIDKSPEDAT
SPSELVQLFNAQTRKVDIPT
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
tggaaagccgatgaactagcaccatacttgcatctggcacgcacgtttgaactcgttgag
aaagagagtggtcgctatcgtaccacagaaatgctgtgtaacatgttccggagtttgcta
gcgctgtcatcggcagatgttcttgctgcactgtatttgacaacaaatcgtatcgccccc
gattatgaaaatgtggacctgagcatcggaacagctaccgtggttatggctattgaagaa
gcaacaggaacaccgaagtccaaacttaaggagatgtacaaccgtatgggcgatctgggt
gacgttgcacaagcatgcaagcaaacacaatccatgctgaggaatccgcaaccgttactg
atacgtcacgttttcagcacattaaagcagataagcaaagaaaccggcatcggaagcagt
agtcgcaagaaaaacatggttgtgggtctcctgcgatcatgccgtgagaaggaagtcaca
tatcttgtacgcactctggtacagaacatgagaattggtgctatggtacgaacggttctt
ccagctctggcagaagcggttgtattacatcgggacaattctgcagtagcggccttgaag
catcaggaagtgtcagcgctaattgtagaggcgttcaatcttgttccaaattttgacata
ctagttccgtttctactagaacaaggcatggtagcactagctacgaggatggttttaacc
cctggaattcccataaagcccatgctagcaaaaattgcaaacggggtccctgacgtgttg
aaaatctttgaaggaaaatcgtttacgtcggagtttaagtatgatggctttcgagcacaa
attcatcttttagacgacggatccgttcgaatcttttctcgtaattgcgagaattcaacg
tcgcgtttcccggatgtggtcgaaattattaagtcgtcaacgatcaaaagagacagccga
tcatttatcatcgacgcagagctggtcgcagttgacagggcaaacaacaataagttaatg
gccttccagtcactcagtactcgtgagagagggggacgaacagggacgggtgtggatttg
gacaaaattacggtcaacgtttgcgttttcgtcttcgatgttatgtacgtggatggtgaa
ccgtttgtaaaagcacctctcaggctcaggagacgacgcatgcatgacttgtttccagaa
gtaaggcctggttatctcgattttgcggcggagaagactgagcataacacggagcatatc
caggacttcttgggacaagctattgctgcttcatgtgaaggattaatggtaaaggccctg
gacgaaggctcgttttacgctccagcaaaaagagcagaatcttggctcaagctgaagcga
gattatgtcgagggattgagcgatagtcttgaccttgtacctattggagcttggtatggg
aatggacgcaaagctggatggcatagcccgtttctccttgcgtgctacgatcctgatcag
gaggtattccaaagcgtttgccgcgttatgtccggcttcaccgacgccttttacgagcag
atgaaggagttttactcggaggacaagcttctaagcaaaaaaccaagctactatcaaact
ttggagcggcccgatgtgtggttcgcagctgctaaagtgtgggagattcgcggcgccgac
tatacaatctccccggttcaccaggcagccgctggcctagtccatccagaccgaggcatt
tccttacgcttccccagattcgtgggcgagaggatcgacaagtccccggaagacgcaacg
tcgccgagcgagctcgtacagctcttcaacgcgcagacccgcaaagtcgacattccaaca
taa

DBGET integrated database retrieval system