KEGG   Spirosoma montaniterrae: AWR27_04975Help
Entry
AWR27_04975       CDS       T04702                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
smon  Spirosoma montaniterrae
Pathway
smon00380  Tryptophan metabolism
smon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AWR27_04975
Enzymes [BR:smon01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AWR27_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AQG78738
UniProt: A0A1P9WTR4
LinkDB All DBs
Position
1154905..1156182
Genome map
AA seq 425 aa AA seqDB search
MTYENTLAFARHLDDTDPLRHFRKRFHIPQRNGQELIYLCGNSLGLQPKSARAALEQELN
TWQSLGVEGWFETPEGATQNWLGYHNSCKTALSQIVGAQPAEVCPMNALTVNIHLLLTSF
YQPTPEKYKILTILGDFPSDQYALETHVRHRGYTPTDAIIEITPREGGESTRGLIHTTDI
QHAIAQHADELAVVWMSGLNYYTGQVYTMAAIAETARRYGIPVGFDLAHAIGNIPLQLHD
WGVDFATWCSYKYLNGGPGAVSGVFVHQKHHDRNLPRLAGWWGYREDRRFEMKPGFLPAP
GADGWQLSTPNIPALALHRAAIAITAEAGMAALRQKSELLTGFLELVLRPFPQISILTPA
DANQRGCQLSLLVRKNGKALFEQLTQAGIIGDWREPDCIRLAPTPLYNTFEDVWRVGEAL
HRFLG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgaaaacacgctggcctttgcgcgtcatctcgacgacaccgatccgcttcgc
cacttccggaagcgtttccatattccgcaacgcaacgggcaggaattgatttacctctgt
ggtaattcgctgggattgcagcctaagtccgcccgcgctgcgttggaacaggaactgaat
acctggcaaagtctgggtgtggaaggctggtttgaaacgcccgaaggcgcgacgcaaaac
tggctcggctatcataatagctgcaaaacggcactgtcgcagatcgtaggcgcacagcct
gcggaggtttgcccaatgaacgcgctgaccgtaaacattcatttgctgctgacgtcattt
tatcagccaacgccggaaaaatacaagattcttaccattctgggtgatttcccgtcggat
caatacgcgctcgaaacgcacgtgcggcatcggggctataccccaaccgacgcgattatt
gaaataactccccgcgaaggtggcgaatccacgcggggactcattcataccacagatatt
cagcacgctatcgcccaacatgccgatgaactggctgtagtctggatgagcggcctgaat
tattataccgggcaggtctatactatggctgctattgccgaaacagcgcgtcggtatggc
attccggttgggttcgatctggcgcacgccattggcaacatcccgctgcaactccacgac
tggggcgttgattttgccacctggtgttcttacaaatacctcaacggtggtcctggtgcc
gtgtcgggcgtgtttgtccatcaaaaacaccatgaccgtaacttgccccggctggcggga
tggtggggataccgcgaagaccggcgatttgagatgaaacccggttttttgcccgcgccc
ggtgccgacggctggcaactgagcacccccaacattccggcactggccctgcaccgggcc
gctatcgcgatcacagcagaggctggtatggctgccctgcgccagaaaagtgagctactc
acaggattcctcgagttggtgctacgtccgtttccgcaaatcagcatcctgacgcctgcc
gacgctaatcagcgcggttgccaactgtcactgctggtacggaaaaacggcaaagcctta
ttcgagcaactgacgcaggcgggtattattggcgactggcgcgaacccgattgtatccgg
ctcgcgcccacaccgttgtataatacgtttgaagacgtttggcgggtaggagaggcccta
caccgatttctcggctga

DBGET integrated database retrieval system