KEGG   Spirosoma montaniterrae: AWR27_06835Help
Entry
AWR27_06835       CDS       T04702                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smon  Spirosoma montaniterrae
Pathway
smon00473  D-Alanine metabolism
smon01100  Metabolic pathways
smon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWR27_06835
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AWR27_06835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smon01011]
    AWR27_06835
Enzymes [BR:smon01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AWR27_06835
Peptidoglycan biosynthesis and degradation proteins [BR:smon01011]
 Precursor biosynthesis
  Racemase
   AWR27_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C Peptidase_S41_N
Motif
Other DBs
NCBI-ProteinID: AQG79064
UniProt: A0A1P9WUK7
LinkDB All DBs
Position
1569386..1571857
Genome map
AA seq 823 aa AA seqDB search
MIWLTDSRQATGNLSDVLFFAIRGEHHDGHDFIDDLYNKGVRHFVVETPALTPARLAKLA
DYADARFTEVDNSLTHLQTLAAAHRQQFRIPVIGITGSNGKTIVKEWLAQLLADDFAIAR
SPRSYNSQLGVPLSVQQLADHHTLGIFEAGISRPQEMAALEAIIRPTIGIFTNIGTAHDE
GFRTRRQKIAEKLRLFIHAQTLVYCADHTDIADEINMVLKAVNPDMRLITWSLTGQNATY
KAHRNGNRLHLTGPRGDYHLTLPFTDPASVENVLHCLVTMLLFRSFNVDALQTRLSRLRP
VSMRLEQKEGINNCVLIDDSYNNDLAGLQLALNFLNQQTGRSGRVVILSDVLQSGQSESD
LYAQISGLIEANLIDRFVGIGPVMSRNAGLFPPNSLFYETTDQFLAQFSVSALRDSAVLV
KGARTFSFERIVNRLQRKVHGTVLEINLDALTHNLNYYRERISRTDGPSATKIMVMVKAF
AYGSGSAEVAQLLQYHRVDYLAVAYADEGVSLRQNGITLPIMVMNPAPETFATLLEYGLE
PEIYSLRLLREWGLFAAAVAGSYGQGVPDSQSKDLPNLHLKIDTGMHRLGFLETEMPELI
AYLQQHPQLRIATVFSHLAGADESQFNAFSQQQYQTFLRCTEALEAGLGYRPVRHLLNSA
GIVRFPDYQLDMVRLGIGLYGVESSQTDVSAVRPVGTLRTVVSQIKCVLAGESVGYSRRG
VLDHDARIATLAIGYADGFDRRLGNGVGRVWVNGTLCPTVGSVCMDMTMIDVTAASVQEG
DEVIIFGPDLPITELARQINTIPYEVLTGISERVKRVFVKEGN
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgatttggcttactgactcgcgacaggcgacgggaaatttatccgacgttctatttttt
gccattcggggcgaacaccacgacgggcacgattttattgatgacctgtataacaagggc
gtccggcatttcgtcgttgaaaccccggcactaacgcccgcccgtttagccaaactggcc
gactacgccgacgcacggttcacagaagtagacaacagcctgacgcacctgcaaacgctg
gcggctgcgcatcggcagcagtttcgcattccggttattggcatcaccggcagtaacggc
aaaaccattgtcaaagaatggctcgcgcagcttttagccgatgacttcgctattgctcgt
agcccgcgtagctataactcgcagttaggtgtgccgctatcggtacagcaactggctgac
catcacacgcttggcatctttgaggccggtatttcgcgcccgcaggagatggccgccctc
gaagccataatccggcctaccatcggtattttcaccaacatcggcacggcccacgacgaa
ggtttccgaacgcgacggcagaagatagccgaaaaacttcggctgttcattcatgcccaa
acgctcgtctactgcgccgaccacaccgatattgccgacgaaataaacatggtgctgaag
gccgtgaaccccgatatgcggctcattacctggtcattgacgggtcaaaacgctacctac
aaggcgcatcgaaacggcaatcgcctgcacctgaccgggccacggggcgactatcacctg
acactgcctttcaccgatccggcgtcggtcgaaaacgtgctgcactgcctcgttacgatg
cttctgttcaggtcgttcaacgttgatgcgctgcaaacccggctcagtcgattgcggcct
gtgtcgatgcggcttgagcagaaagaaggcatcaacaactgcgtattgatcgatgattca
tacaataatgatctggccgggctacagttggcactcaactttctgaatcagcaaacgggc
cgcagcgggcgcgtcgtgatcttgtccgatgtattgcagtcgggacaatctgagtccgac
ttatacgcgcagatttcggggttgatagaagccaacctgatcgaccggtttgtgggcatc
ggcccggtgatgagccgtaacgccggtctgtttccgcccaacagccttttttacgaaacc
accgatcagtttttagcccagttttcagtcagtgcgttgcgcgatagtgcggtgctggta
aaaggggcgcgaacgttctcgttcgagcggatcgtaaatcgactgcaacgcaaggtgcat
ggaacggtgctggaaattaatctcgacgcgctgacgcacaacctcaactactaccgcgag
cgcattagtcgtaccgatgggccatcagccacgaaaattatggtgatggtgaaggcgttt
gcctacggcagcggcagtgccgaagtagctcagttgcttcagtatcaccgcgtcgactac
ctcgccgtggcctatgccgacgaaggcgtttcgctccggcaaaacggcatcacgctgccc
atcatggtgatgaaccccgcgcccgaaacgttcgccacattgctggaatatggtctggaa
cccgaaatctacagcctgcgcctgttgcgggagtggggactgttcgcagcagcggtggca
gggagctacgggcagggagtgccggatagccaaagcaaagatttgccaaacctgcacctg
aaaattgacaccggcatgcaccggctggggtttctggaaaccgaaatgcccgaactgatt
gcctacctgcaacagcatccgcaattgcgcattgctacggtgttcagccatttggcaggt
gccgatgagtcgcagttcaacgccttttcgcagcagcaataccagacgtttttgcgctgt
accgaagccctcgaagccgggttgggataccgcccggtgcgacatctgctcaattcggcg
ggcatcgtgcgctttcccgattaccaactcgacatggtgcggttaggcattgggctgtac
ggcgttgaatcgagtcagaccgacgtatcagcagtaaggcccgtgggtacgttgcggacg
gtggtgagtcagatcaaatgcgtattggcgggcgagtcggtaggctacagccgtcggggc
gttctggaccacgatgcccgtattgccacgctggcaattggttatgccgacggattcgac
cggcgattgggcaacggtgtgggtcgggtgtgggtcaacgggacgctttgccccacggtt
ggcagcgtgtgcatggacatgaccatgatcgatgtcacagccgcatcggtgcaggaaggc
gacgaggtaatcattttcggccccgacctgcccattaccgaattagcccgacagataaac
acgataccttacgaagtactgaccggcatcagcgaacgcgtaaagcgggtgtttgtgaag
gagggaaattaa

DBGET integrated database retrieval system