KEGG   Spirosoma montaniterrae: AWR27_12490Help
Entry
AWR27_12490       CDS       T04702                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
smon  Spirosoma montaniterrae
Pathway
smon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    AWR27_12490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smon01004]
    AWR27_12490
Enzymes [BR:smon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     AWR27_12490
Lipid biosynthesis proteins [BR:smon01004]
 Desaturase
  Front-end
   AWR27_12490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AQG80071
UniProt: A0A1P9WXH8
LinkDB All DBs
Position
complement(2900661..2901788)
Genome map
AA seq 375 aa AA seqDB search
MTTKLKFTPTSQSLFFVTLRRRVDAYFTQQACSPHANRAMWAKALFFLIGYALLYALLLS
NQFGPLGSLGLAITLGVFAACIGFNVSHDALHGAFSSRPWVNRLLGNSFYLLGANPYVWK
ITHNVVHHTYTNIPGHDEDIEIAPGLVRLDPEEPLRPWHRYQHLYTIPLYSLASLSWVLR
KDYVKFFKHQIGQHTPPAHPRSEYVNLFLGKALYYVFFLVIPLLVLDLAWWQVLLGFLIM
HLAEGLVLGLVFQLAHVVEGTSFPIPDASGSVDDAWAIHQLRTTANFAPRSQLAAFICGG
LNRQIEHHLFPKVCHIHYPAITAIVRQTAHEFDLPYLENPSFGSALFSHFRLLRTMGQQE
QGLQVDAFLKNTVNV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaaacttaagtttacgccgaccagccagtcgctgttttttgttacgctgcgc
cgtcgggtcgatgcgtattttactcaacaagcatgttctccccatgccaaccgggctatg
tgggctaaggctctcttttttttgattggttacgcgctgctatacgcgcttttgttatcc
aatcagtttgggccactgggcagcttaggcttagccattaccttgggcgtatttgccgcc
tgcatcggcttcaacgtgtcgcacgatgcactgcatggagcattttcgtcgcgcccgtgg
gtcaaccggctcctgggcaatagcttttacctgctgggggccaacccctatgtctggaaa
attacgcataacgtggtgcatcacacctacacaaatattcccggtcacgacgaggacatt
gagattgcaccgggtttggtacggctcgaccctgaggagccactccgaccctggcaccgc
taccagcatctgtacacgattccgctgtactcgctggcatcgctctcgtgggtactccgc
aaagattatgtcaagtttttcaagcatcagattgggcagcatacgcccccggcgcatccc
cgaagcgaatacgttaacctgtttttgggaaaagccctgtactacgtctttttcttggtg
ataccgctgctcgtactcgatctggcctggtggcaggtgctgctcggctttctgattatg
cacttagccgaaggactggtgctgggactggtgtttcaactggctcacgtggttgaagga
acatcgtttccaattcccgacgcatcggggtcggtagacgatgcctgggctattcaccag
cttcgtacaacggccaactttgctccccgtagccaactggcagcttttatatgtggtggg
ctgaaccgtcagatcgaacaccatctgtttccgaaagtctgccacatacactacccggcc
atcacggcaatcgtcaggcaaactgcccacgagtttgacttgccgtatctggaaaacccc
agtttcgggtctgcgctcttctcccatttccggttgttgcgtacaatgggccaacaagag
caaggtttgcaggtcgatgcttttcttaaaaacacagtcaatgtctga

DBGET integrated database retrieval system