KEGG   Sordaria macrospora: SMAC_01241Help
Entry
SMAC_01241        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smp  Sordaria macrospora
Pathway
smp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SMAC_01241
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smp02000]
    SMAC_01241
Enzymes [BR:smp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SMAC_01241
Transporters [BR:smp02000]
 Other Transporters
  Pores ion channels [TC:1]
   SMAC_01241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_N GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 10810044
NCBI-ProteinID: XP_003352407
LinkDB All DBs
Position
Unknown
AA seq 342 aa AA seqDB search
MSFILRSPALSKLPRTLNSSIKTPFRQLNSTSLPPIQNRPKRNMSSKTSKPAAVDTSLQG
SPTGAAASFASSHSSDHPLKLYGGWFCPFVQRVWITLAEKNIPHQYIEINPYHKAPEFLA
LNPRGLVPTLAVPTVTDPKTGKVKEVKPLYESLVLCEYLDEAYADPNQYGERLLPQEDAY
ERARCRLWIDHISSRIVPSFYRFIQHTPDKAYTIEEIRAEFHGHLKAFAKEMLSCLSYPG
PFFLGNKFSLVDIMLAPWAKRLFLIDHYKPGGVGIPSTKEQRGEDEEVWKRWEEWYNAVV
QRESVKKTWSDDEQYVGAYKRYAEDTTQSEVGKATRSGRSLP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcatcctccgttcgccagcgctatccaagctcccgcgaactcttaactcttcc
atcaagaccccatttcgccaactcaacagcacatctcttcctcctatacagaaccgcccg
aagcgcaatatgtcgtcgaagacctccaaacccgcagccgtcgacacctccctccaaggc
tcccccactggcgccgccgcctctttcgcctcctcccactcctccgaccaccccctcaag
ctctacggcgggtggttctgtcccttcgtgcagcgagtatggatcaccctcgccgagaag
aacatcccacaccaatacatcgaaatcaacccctaccacaaagcgcccgagttcctcgca
ctcaacccacgggggctggtccccactctcgccgtgcccacggtaaccgatccaaaaaca
ggaaaagtgaaggaagtcaagccgctgtacgagagtctggtgctttgcgagtatctagat
gaagcctacgcagaccccaaccaatatggcgagcgcctgctcccgcaagaagatgcctac
gaaagagctagatgccgtctctggatcgaccacatctcctcgcgaatcgtcccgtctttc
taccgcttcatccagcacacgcccgacaaggcgtacacgatcgaagagatccgggcagag
tttcatggtcacctgaaagcgtttgcgaaggaaatgctttcatgcctttcttatccggga
ccattcttcctaggcaacaagttcagtctggtagacattatgctagcaccctgggccaaa
cggttgttcctgattgatcactataaacctggtggagtggggattccgtccaccaaggaa
caaaggggagaagatgaggaggtgtggaagaggtgggaagagtggtacaatgccgttgtc
caaagggagagtgtcaagaagacgtggagtgatgacgaacaatatgtgggtgcgtataag
aggtatgcggaggatacgacacagagtgaggtggggaaggcgacgaggagtgggaggagt
ttgccttga

DBGET integrated database retrieval system