KEGG   Sordaria macrospora: SMAC_01265Help
Entry
SMAC_01265        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
smp  Sordaria macrospora
Pathway
smp00010  Glycolysis / Gluconeogenesis
smp00051  Fructose and mannose metabolism
smp00052  Galactose metabolism
smp00500  Starch and sucrose metabolism
smp00520  Amino sugar and nucleotide sugar metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
smp01200  Carbon metabolism
Module
smp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMAC_01265
   00051 Fructose and mannose metabolism
    SMAC_01265
   00052 Galactose metabolism
    SMAC_01265
   00500 Starch and sucrose metabolism
    SMAC_01265
   00520 Amino sugar and nucleotide sugar metabolism
    SMAC_01265
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMAC_01265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smp04131]
    SMAC_01265
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SMAC_01265
Membrane trafficking [BR:smp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SMAC_01265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Ribosomal_S11
Motif
Other DBs
NCBI-GeneID: 10810067
NCBI-ProteinID: XP_003352431
UniProt: F7VQB6
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MALETQTKTVVGQFDYSDEDVNKGVTEFLRQMSEGLEKDGASLSQIPTYVTAVPNGTEKG
LYMAVDLGGTNFRVCSIQLNGDTTFRLTYTKVAIPKELMVAKTAEELFAFLAKQIEIFLR
THHGEHFEAHIRRRMTMSSPEGFKDENVFRLGFTFSFPVQQLGINKGTLIRWTKGFDIPD
AVGKDVCALLQTEIDKLHLPVKVAALVNDTVGTLMARSYSSPGKSGAILGAIFGTGTNGA
YVEKLSKLKKPLAGEYDNSTGEMVINTEWGSFDNQLKVLPNTPWDIQLDQATPNPGIQMY
EKRVSGMYLGEILRLAVIDLLKNPDVAFFRDENSSSNDWRSTTNIAEHSPLFKQWGVDTS
VLSVAAADTTPELSILRQELESNLHVYAPSLEDAQAFKAIACAIGRRAARLSAVAIAAIV
LQTGKLTDPELEGEPIDIGVDGSLVEHYPYFRDMIYEALRAIKGVGEEGAKRIRIGIAKD
GSGVGAALIALVAAGMEKTTSTTDFITDLRLNAKKTDLTAVPEHSELSELAAAE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgagactcagaccaagaccgttgtcggtcagttcgactactcggacgaggat
gtcaacaagggtgtcacagagttccttcgtcaaatgtccgaaggtctcgagaaggatggt
gctagcttgagccagattcccacatacgtcactgccgttcccaatggtaccgagaagggc
ctttacatggccgtcgaccttggcggcaccaacttccgtgtttgttcgatccagcttaac
ggcgacaccaccttccgtctcacatacaccaaggtcgccatccccaaagagcttatggtt
gccaagaccgctgaggaattgttcgctttcttggcgaagcagatcgaaatcttcctcagg
acacatcacggcgagcacttcgaggcacacatccggagacgcatgaccatgagctctccc
gagggcttcaaggacgagaacgtcttccgtctcggcttcactttcagcttccccgtccaa
caactgggtattaataagggtacactcattcgctggaccaagggtttcgacatcccagac
gccgttggaaaggatgtctgtgctctcctccaaaccgagattgacaagctccatctcccc
gtcaaggttgccgccctcgtcaacgacactgttggtactttaatggctcgctcctactct
tcccctggcaagagcggtgctatcctcggcgccatcttcggtactggcaccaacggtgct
tacgtcgagaagctctccaagctcaagaagcctttggccggcgagtacgacaattctacc
ggggagatggtcatcaacaccgagtggggctcgttcgacaaccagctcaaggtcctcccc
aacacaccatgggatatccagctcgatcaggccacccccaaccccggcattcagatgtac
gaaaagcgtgtctccggcatgtacctcggcgagatcttgcgattggcagtcatcgatctg
cttaagaacccagacgttgctttcttcagggacgagaactcgagctccaacgactggagg
tctaccaccaatattgccgaacactctcctctcttcaagcagtggggtgtcgatacctcg
gtcctgtctgtcgctgccgctgacactacccccgagttgtccatcctccgccaggagctc
gagtctaacctccacgtttatgccccatcgttggaggacgcccaggctttcaaggccatt
gcctgtgccatcggtcgccgcgctgctcgtctttcggctgttgccattgctgccatcgtt
cttcagaccggcaagctcaccgaccccgagctagaaggcgagcccatcgacattggtgtt
gacggaagcttggtcgagcactacccctacttccgcgacatgatctacgaggctcttcgt
gctattaagggcgttggtgaggagggtgccaagcgcatccgtattggtattgccaaggac
ggatctggtgttggtgccgctttgatcgctctcgtcgccgcgggaatggagaagaccact
tccaccaccgacttcatcaccgacctccgtctcaacgccaagaagaccgatctgacagcc
gtgcctgagcacagcgagcttagcgagcttgccgccgcggaatag

DBGET integrated database retrieval system