KEGG   Sordaria macrospora: SMAC_01605Help
Entry
SMAC_01605        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
smp  Sordaria macrospora
Pathway
smp00020  Citrate cycle (TCA cycle)
smp00190  Oxidative phosphorylation
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01130  Biosynthesis of antibiotics
smp01200  Carbon metabolism
Module
smp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMAC_01605
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SMAC_01605
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SMAC_01605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Flexi_CP_N
Motif
Other DBs
NCBI-GeneID: 10810393
NCBI-ProteinID: XP_003352771
UniProt: F7VRA6
LinkDB All DBs
Position
Unknown
AA seq 649 aa AA seqDB search
MSSLAWRKLAAAPTLARAASRVQNRAFSSTRPAARVIAPGGPLRAKEASPHLSNKYHVID
HEFDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDW
RWHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSKE
FGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQ
EDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGSAMVARAGLPNQDLEFVQFHPTG
IYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGP
EKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTG
EVLTVDEKGNDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPS
AKLKPVAADAGADSIEVLDKIRTSDGPKSTAEIRLAMQKTMQRDVSVFRTQESLDEGVEK
ITQVDQMFDQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAANRKESRGAHAREDYP
ERDDANWMKHTLSWQKQPHGKIELGYRRVIDKTLDEKECAPVPPFKRVY
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttggcttggagaaagttggctgcggcgcccacgcttgcgcgtgccgccagc
agagtccagaacagagccttttcctcgacaaggccggccgcccgcgtcatcgctcccggt
ggtcctctccgcgctaaggaggcttctccccatctcagcaacaagtaccatgtcatcgac
cacgagttcgatgccatcgttgtcggtgccggcggtgccggtctccgtgccgctttcggt
ctcgccgaggctggcttcaacactgcctgcatttccaagctcttccccaccagatctcac
accgtcgctgcccagggtggtatcaacgctgcgctcggcaacatgcacgaggatgactgg
agatggcacatgtacgacaccgtcaagggctccgactggctcggtgaccaggatgctatt
cattacatgacccgtgaggctcccgcctccattgtcgagctcgagaactacggctgcccc
ttctcccgtaccgaggacggcaagatctaccagcgtgctttcggtggtcagtccaaggag
ttcggcaagggcggccaggcttaccgctgctgcgctgctgccgaccgtaccggccacgct
cttctccacaccctctacggccagtctctccgccacaacaccaactacttcatcgagtac
ttcgccatcgacctgatcatgcaggatggtgagtgccgtggtgtcctcgcctacaaccag
gaggacggcaccctccaccgtttcctcgccaacaacaccgttctcgccaccggtggatac
ggacgcgcctacttctcctgcacttccgcccacacctgcactggtgacggttccgccatg
gttgcccgtgccggtctccccaaccaggatctcgagttcgtccagttccaccctactggt
atctacggcgccggctgcttgatcaccgagggtgctcgtggtgagggtggttacctcctc
aactccgagggtgagcgtttcatggagcgttatgctcctaccgccaaggatctcgcttcc
cgtgacgtcgtctcccgctccatgaccatggagatccgcgagggtcgtggtgtcggcccc
gagaaggaccacatctacctccagctcagccatctccccgctgagattctcgccgagcga
ctccccggtatctccgagaccgccggtatcttcgctggtgtcgatgtccgcaagcagccc
attcccgtcctccccaccgtccactacaacatgggtggtatccccactcgctacactggt
gaggttcttaccgtcgacgagaagggcaacgacaaggttgtccctggtctcttcgcttgc
ggtgaggctgcttccgtctctgtccacggtgctaaccgccttggcgccaactctcttctc
gacttggtcgtcttcggccgtgccgtctcccacaccatccgtgacaacttcactcctagc
gccaagctgaagcccgttgccgccgatgccggtgccgactccatcgaggtcctcgacaag
atccgcacttccgacggtcccaagagcaccgccgagatccgcctcgccatgcagaagacc
atgcagcgcgacgtctccgtcttccgtacccaggagtcccttgacgagggtgttgagaag
atcacccaggtcgaccagatgttcgaccaggtcggtatcaaggaccgctccatgatctgg
aactctgatctcgtcgagacccttgagctccgcaacttgctcacttgcgctacccagacc
gccgtctccgccgccaaccgcaaggagtctcgtggtgcccacgcccgtgaggattacccc
gagcgtgacgacgccaactggatgaagcacactctgtcttggcagaagcagccccacggc
aagatcgagctcggttaccgccgtgtcattgacaagaccctcgacgagaaggagtgcgct
cctgtccctcccttcaagcgtgtctactaa

DBGET integrated database retrieval system