KEGG   Sordaria macrospora: SMAC_03492Help
Entry
SMAC_03492        CDS       T01610                                 

Gene name
putative mak2
Definition
(RefSeq) putative MAK2 protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
smp  Sordaria macrospora
Pathway
smp04011  MAPK signaling pathway - yeast
smp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:smp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SMAC_03492 (putative mak2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    SMAC_03492 (putative mak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smp01001]
    SMAC_03492 (putative mak2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smp03036]
    SMAC_03492 (putative mak2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smp04147]
    SMAC_03492 (putative mak2)
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SMAC_03492 (putative mak2)
Protein kinases [BR:smp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   SMAC_03492 (putative mak2)
Chromosome and associated proteins [BR:smp03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     SMAC_03492 (putative mak2)
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SMAC_03492 (putative mak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7 Gag_p6
Motif
Other DBs
NCBI-GeneID: 10808774
NCBI-ProteinID: XP_003351189
UniProt: F7VVC1
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MSSAQRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAVHKPSGQKVAIKKITPFDHSMFC
LRTLREMKLLRYFNHENIISILDIQKPRSYDTFNEVYLIQELMETDMHRVIRTQELSDDH
CQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMT
EYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLG
TPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITVE
EALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYNEIMR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcacaaagaggcggagctcgcaagatctccttcaacgtcagcgagcagtat
gatattcaggatgtcgtaggtgaaggcgcctacggtgtcgtctgctctgcagtacacaag
ccttcgggccaaaaggtcgccatcaagaagatcaccccctttgatcactccatgttctgc
ttgcggacgttgcgcgagatgaagctgcttcggtacttcaaccatgaaaacatcatctct
attctagatattcaaaaaccacggagctacgacaccttcaacgaggtctatctcatccag
gaacttatggagactgacatgcaccgcgtcattcgtacccaagagctatcggacgaccat
tgccaatacttcatttatcagacgttgcgcgccctcaaggccatgcactcggccaatgtt
cttcatcgcgacttgaaaccctccaaccttttgctaaacgccaactgcgatctgaaagtg
tgcgactttggcttggcccgctcggccgcgtcgcaagaggacaactcgggcttcatgacc
gaatacgttgccacccgttggtaccgcgcccccgagatcatgttgaccttcaaggagtac
accaaggccatcgatgtctggtccgttggctgcattttggccgagatgttgagcggcaag
ccactcttccctggcaaggactatcaccaccaactgaccctcatcctggacgttctcggc
acgccgaccatggaggattactacggcatcaagtcgcgccgcgcccgggaatacatccgc
tcgctgcccttcaagaagaaggttcccttccgcacgctgttccccaacacgtcggaactg
gccctggacctgctagaaaagctgcttgccttcaaccctgttaagcgcatcacggtcgaa
gaggcgctcaagcacccgtacctggagccttaccacgacccggatgatgagccgaccgca
cctcccattcccgaggagttctttgatttcgacaagcacaaggataacctgagcaaggag
cagctgaagcagttgatctacaacgagatcatgaggtga

DBGET integrated database retrieval system